(data stored in SCRATCH zone)

EMBL: CP000885.PE340

CP000885.PE340       Location/Qualifiers
FT   CDS_pept        437841..438587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0344"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: cno:NT01CX_0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40731"
FT                   /db_xref="GOA:A9KST7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST7"
FT                   /protein_id="ABX40731.1"
FT                   /translation="MENLEKLMEVAKTNVGFLLLSVTIVAIIVGAAYAAERVIRKKIGL
FT                   DKRRGKQSVRSMVIIAVLSTIAVVLMLFEFPLWFAPGFYKLDFSELPVVIGAFTLGPVA
FT                   GITIELIKIVLNLLLNGTTTAFVGEFANFLMGCVFIIPASFFYFLRKSKKNAVIGLLVG
FT                   TVIATLTGCFLNAFVLLPKYSEAFHIPIEAFIAQGTEKISAIKGMFTFVVLAVAPFNLL
FT                   KYALVSLITILIYKNISKILKGDYKD"
     atggaaaact tggagaaact aatggaagta gcaaaaacca atgtcggatt tttgttgcta        60
     agtgtaacga ttgttgcaat tattgttgga gctgcctatg cagctgagcg tgtcattagg       120
     aaaaaaatcg gattagataa aagaagagga aaacaaagtg tacgcagtat ggtgattata       180
     gcagtacttt ccacaatagc agttgttttg atgctctttg agtttccatt atggtttgcc       240
     cctggtttct ataaacttga ctttagcgag cttccggtgg ttattggtgc atttacgtta       300
     ggtccggtag ctgggataac gatagagctt attaaaattg tcctaaactt actattaaat       360
     ggaacgacaa cagcatttgt tggggagttt gcgaacttct taatgggttg tgtatttatt       420
     attccagcat ctttcttcta tttcctaaga aagagtaaga aaaatgcagt gattggatta       480
     cttgttggaa cagtaatagc tacattaact ggatgtttct taaatgcatt tgttttatta       540
     cctaaatatt cagaagcctt tcacatacca attgaagctt ttattgcaca aggtacggaa       600
     aaaatatctg cgatcaaggg tatgtttact tttgtagtgt tagcagttgc accatttaat       660
     ttgttaaaat atgcattggt atcgttaatt accattttaa tttacaaaaa tataagtaaa       720
     atcctaaaag gagattacaa agattag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page