(data stored in SCRATCH zone)

EMBL: CP000885.PE347

CP000885.PE347       Location/Qualifiers
FT   CDS_pept        442647..443312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40738"
FT                   /db_xref="GOA:A9KSU4"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU4"
FT                   /protein_id="ABX40738.1"
FT                   /translation="MVELSTKKMLMPQGEYVGKGSDFMKGSKKSSKNNTVMSVITMIFI
FT                   GCVIVGSFAYLYNREKKDKPDIELTEVQKLLVMDLERTYPATPREVVKLYSRFSMCIHN
FT                   DDLTDEEFKKLGEKVQNLYAKELIEENPSDEYLMNLAVEVAEYHKSERKIKSYTIDSGN
FT                   SIVTWKEDGKEFARLLATYSLREGKEFNTVHQEFLLQKDEAGLYKILGWRLAEKADAN"
     atggttgaat tatcaacaaa aaaaatgctt atgccacaag gggagtatgt ggggaaagga        60
     tctgatttta tgaagggttc taaaaagagt tcaaagaaca atacagttat gtcagtgata       120
     acgatgattt ttatagggtg tgtgattgtc ggttctttcg cttatctata taatcgagag       180
     aaaaaagata agccagatat tgaattgaca gaggttcaaa agcttctggt aatggattta       240
     gagcgtacat atccagctac acctagagaa gtggttaagc tgtatagtag attttcaatg       300
     tgtattcata atgacgatct aacagatgaa gagtttaaaa agcttggaga gaaagttcaa       360
     aacttatatg ccaaagagtt aatagaagag aatccttccg atgaatatct tatgaattta       420
     gcagttgagg ttgcagaata ccataagtct gaacggaaga ttaaaagtta tacgatagat       480
     tctgggaata gtattgttac ctggaaagaa gatggaaaag agttcgcaag acttcttgct       540
     acttactctc tgagggaagg caaggaattt aatacagtcc accaagaatt tttacttcaa       600
     aaggatgaag ctggacttta taagattctt ggttggagat tggctgaaaa agcagatgca       660
     aactaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page