(data stored in SCRATCH zone)

EMBL: CP000885.PE350

CP000885.PE350       Location/Qualifiers
FT   CDS_pept        452927..453502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0169480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40741"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU7"
FT                   /protein_id="ABX40741.1"
FT                   /translation="MSSCTDILLISSVACRIAECLDDNELALLAADLLFLSDALNAIAV
FT                   RRAVCKDICEKKAANTAKNSKDSNANSGNNNSNNNNSNNNNSSENNGSNDNRGNKGNKD
FT                   GNGNKVGKNNKDSKSNNGNSASSGSSIKQISDEKNVITPVKREQSSEMKTSGSSNMKAT
FT                   FTKNDNSMKMGDNKIVDMSEDINHSNKK"
     atgagtagtt gtactgatat actgttgata agctctgtag catgtcgaat tgcagaatgt        60
     cttgatgaca acgaattagc attgcttgca gctgacttgt tatttttaag tgatgcactt       120
     aatgctattg cggtacgtag agcggtttgt aaggatatct gcgaaaagaa agccgcaaac       180
     acagcgaaga atagtaaaga tagtaatgct aatagcggca ataataatag taacaataat       240
     aatagtaaca ataataatag tagcgagaat aatggtagta atgataatag aggtaacaaa       300
     ggtaataaag acggtaatgg taataaagta ggtaaaaata ataaagacag taaaagtaat       360
     aatggtaata gcgctagtag cggtagtagt ataaaacaaa tcagtgatga gaaaaacgtt       420
     attacaccgg taaaaagaga acaaagctcc gaaatgaaga ctagtgggag tagtaatatg       480
     aaagctacat tcactaaaaa tgataattct atgaagatgg gcgataataa aatcgttgat       540
     atgtcagagg atattaatca tagtaacaag aaatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page