(data stored in SCRATCH zone)

EMBL: CP000885.PE352

CP000885.PE352       Location/Qualifiers
FT   CDS_pept        complement(454276..454560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40743"
FT                   /db_xref="GOA:A9KSU9"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSU9"
FT                   /protein_id="ABX40743.1"
FT                   /translation="MDILIIMGIGIFIGSRFFPEKHKKKNEKMQIVCTILIIFSMGVML
FT                   GKREHFLQEISTLGLTSFLYFFIPTVFSTLIVYLLTRLFMKKKLKEKED"
     atggatattc tcattattat gggaattgga attttcattg gatcaaggtt ttttccagag        60
     aaacataaaa aaaagaatga aaaaatgcaa atagtatgca ccattttaat tattttttct       120
     atgggggtta tgcttggtaa aagagagcat tttcttcaag agatatcaac acttggttta       180
     actagttttc tatacttttt tattccaaca gtcttttcta ctttaattgt ttacttatta       240
     accagattat ttatgaaaaa gaaactaaaa gaaaaggagg actaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page