(data stored in SCRATCH zone)

EMBL: CP000885.PE354

CP000885.PE354       Location/Qualifiers
FT   CDS_pept        457661..458350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0358"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cpf:CPF_1192 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40745"
FT                   /db_xref="GOA:A9KSV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV1"
FT                   /protein_id="ABX40745.1"
FT                   /translation="MKKILVVEDDLNINNMLREALEEAGYEVVQAYSGTEAMLNVGMTE
FT                   FDLILLDLMLPGMSGEEFLKLFNKKERTPVIVLSAKDELDSKVDVLSCGADDYITKPFQ
FT                   LKELLVRIEVALRRVNRNIEKSQDETNQCLSHKDLLLNRSSYEVRLAGNLISLTKQEYK
FT                   ILELLLLHPNKVFSKQEIYNYAWEEYFIGEDKTINVHISNIRMKLKKVTEDDYIDTVWG
FT                   IGFKLSK"
     atgaaaaaaa tattagttgt tgaagatgat ctaaatatta ataacatgct gagagaagcc        60
     ttagaggaag ctggttatga ggtggttcag gcatattcgg gtacagaagc catgctaaat       120
     gtaggcatga cagagtttga tttaattctt ttggatttaa tgttaccggg catgtcagga       180
     gaagagtttt taaagctgtt caataaaaaa gaacggacgc ctgttattgt gctatctgca       240
     aaggacgagc tggatagtaa ggtggatgtc ctatcatgcg gagcagatga ttatattacg       300
     aaaccatttc aattaaaaga attacttgtt cgtattgaag tagctcttag gcgagtaaat       360
     cgaaatatag aaaaatcgca ggatgaaaca aatcaatgtc tttctcataa agacttatta       420
     ttgaatcgta gttcttatga agttagatta gcaggaaatt tgatatcact taccaaacag       480
     gaatataaga tattagaact tttacttctc catccaaaca aggtgtttag taagcaggag       540
     atttataatt atgcatggga agaatacttt atcggtgagg ataagacaat caatgttcat       600
     atcagtaata tccgcatgaa gctaaaaaag gttacagaag acgattatat tgatacggtc       660
     tggggaatag gatttaaact cagtaaatag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page