(data stored in SCRATCH zone)

EMBL: CP000885.PE360

CP000885.PE360       Location/Qualifiers
FT   CDS_pept        complement(464091..464651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0364"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein; KEGG:
FT                   ypi:YpsIP31758_3467 gpr1/fun34/YaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40751"
FT                   /db_xref="GOA:A9KSV7"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSV7"
FT                   /protein_id="ABX40751.1"
FT                   /translation="MSTETKATIANPAPLGLLGFGMTTCLLNLHNAGIIPLSIVTVAMG
FT                   FALGGAAQIIAGIMEFKKNNTFGATAFTAYGFFWWSLILIWMNPTKSIASSDSISLGYY
FT                   LLLWGIFTLFMFIGTLKHNIASRIVFGSLALLFFLLAAANFTDSHSIHTIAGYVGIFCG
FT                   LSAIYNSVAQVINEEYKKTILPL"
     atgtcaacag aaacaaaagc aacgattgcc aatccagctc cacttggttt gctaggattt        60
     ggaatgacaa cctgtttact taacctacat aatgcaggta ttataccgct atccattgtt       120
     accgtagcaa tgggatttgc tctcggagga gcagctcaaa taatagctgg tattatggag       180
     tttaagaaaa ataatacgtt tggagccacc gcatttacag cttacggatt cttttggtgg       240
     tcactcatac tgatctggat gaatccaacc aagtctatag cttcttctga ttctatcagc       300
     cttggatatt atctacttct gtgggggatt tttaccttgt ttatgtttat cggtaccttg       360
     aaacataata tagcatcacg tattgtattt ggttcattag cattattatt tttcttatta       420
     gctgcagcta attttacaga ttcacacagt attcatacca ttgcaggtta tgttggtata       480
     ttttgtggac tctctgcaat ttataattcc gttgcacaag ttataaatga ggaatataaa       540
     aagacaattc taccacttta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page