(data stored in SCRATCH zone)

EMBL: CP000885.PE385

CP000885.PE385       Location/Qualifiers
FT   CDS_pept        complement(499306..500217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0389"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: fjo:Fjoh_4335 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40776"
FT                   /db_xref="GOA:A9KHA9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHA9"
FT                   /protein_id="ABX40776.1"
FT                   /translation="MITLLLVLSITFFILQSVSMKFVKADTLPQKMLVHGVFTLVAGIG
FT                   MSFFLLFSRESFSLSKNTILFGILFGFLFAFTILFYNLAINSGPLSYTAFYFSSSMLLP
FT                   TFFGLLFLKEELRWTLLIAIILFLMAFYFLNVTKESKKEAVSPTHRKQKKQWLFYCILT
FT                   FIGNGCLAIVQKLHQQLQHGTEASGLILLGFAFASLCYFIAYPVAKSKASEVKITTSSS
FT                   VKQLKTNLLPILFLAAGSLLGNLLLTSLAGKIPSSYLFPLVQGSIILGITIISTLFFKE
FT                   KLSNRGKIGILLGVLAIVFINV"
     atgataactc tacttttggt tttaagtatc acctttttca tcttgcaatc agtctcaatg        60
     aagtttgtga aagcagatac gcttccgcaa aaaatgctgg tccatggagt atttacactc       120
     gtggcaggta tcggaatgag tttcttttta ttgttctcca gggaatcctt ttctctaagt       180
     aagaacacga ttttgtttgg tattcttttt ggatttttat ttgcttttac catattattt       240
     tataatctgg caattaacag cggccccctt tcctacacag cattctactt ttcttctagc       300
     atgctgcttc ctaccttttt tggtcttctc tttttgaaag aagaacttcg gtggacgctc       360
     cttattgcta tcattttatt cctgatggca ttttacttcc ttaatgttac aaaagaatca       420
     aaaaaggaag ctgtttcccc cactcataga aaacaaaaaa agcaatggct cttttattgt       480
     attctcacgt ttataggtaa tggttgcctt gctattgttc aaaaacttca tcaacagctt       540
     caacacggca cggaagcttc tgggttaata ctccttggat ttgcctttgc ttctctttgc       600
     tactttattg cttatccggt tgctaagtca aaggcaagcg aggtaaaaat cacgacctca       660
     tcctctgtaa agcaactaaa aactaactta ttaccaatct tgttcttagc agcaggttct       720
     ctacttggaa atttgctatt aacaagctta gcagggaaaa ttcccagcag ttatctgttt       780
     ccactcgtac aaggcagtat tatcctcggc attaccataa tttcaacgct attttttaaa       840
     gagaagttat ctaaccgtgg taaaattggt atccttctag gagtacttgc tattgtgttt       900
     attaacgttt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page