(data stored in SCRATCH zone)

EMBL: CP000885.PE389

CP000885.PE389       Location/Qualifiers
FT   CDS_pept        504230..505210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0393"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3119 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40780"
FT                   /db_xref="GOA:A9KHB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHB3"
FT                   /protein_id="ABX40780.1"
FT                   /translation="MGLKRDKRKDGRARPSKEVRARMRHQSRVLIKRNWALYLFILPAF
FT                   LYFLIFAYAPMYGVQIAFKDFIATKGFGGSPWADPIYKHFKTFFSSVNFSQIFMNTITL
FT                   SLYYMAVSFVTPILLALMINEVGNKYFKKTVQNITYMPYFISTVVLVGMIDLFLSRNGL
FT                   FNQIGAALFHSEPTMFLMKDSLFNDIYVWSGVWQVTGYGAVIYIAALSGVSPELHEAAI
FT                   MDGAGRMQRIRHINLPAIMPTIVVMLIMTVGGIMNLSFEKVLLMQKDGNMMVSEVISTY
FT                   VYKLGIQRAQYSLSSAVGLFNNVINLILLVTVNKISRKVSENSLW"
     atggggttaa aaagggataa aagaaaagac ggtcgagcca gacccagtaa agaggtgaga        60
     gcacggatga ggcatcaaag ccgtgtgtta ataaaaagga actgggcgct gtacttgttt       120
     atattgcctg cattcctgta ttttctaata tttgcgtatg cacctatgta tggagtccag       180
     attgccttta aggactttat tgctacaaag ggatttggag gaagcccttg ggcagacccg       240
     atttataaac atttcaaaac gttttttagt tcagttaatt tttcgcagat atttatgaac       300
     acgatcaccc tttccttata ttatatggca gtcagttttg tgacaccaat tttattagca       360
     ttaatgatta atgaggtagg gaataagtat tttaagaaaa cagtccaaaa tattacatac       420
     atgccatatt tcatttcaac ggtagttctt gtcggtatga ttgatttgtt cctttcaaga       480
     aatggattgt tcaatcaaat aggagccgca ttatttcatt cggagccgac tatgttcttg       540
     atgaaggata gcctgtttaa tgatatttat gtgtggagtg gtgtttggca ggtaaccgga       600
     tatggtgcag taatttacat tgccgcacta agcggtgttt cacctgaact tcatgaagca       660
     gcaattatgg atggtgctgg acgaatgcag cgaatccgac atattaattt accagccatt       720
     atgccaacga ttgtggttat gttgattatg acagttggcg gtatcatgaa cctttcattt       780
     gaaaaggtgc tgctgatgca aaaggatgga aatatgatgg tttcggaagt tatctctacc       840
     tatgtatata agttaggtat acaaagagca cagtacagtt tatcctctgc agtcgggtta       900
     ttcaataatg taattaacct gattctattg gtaacggtta ataagatttc aagaaaagtc       960
     agcgaaaact cattatggta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page