(data stored in SCRATCH zone)

EMBL: CP000885.PE39

CP000885.PE39        Location/Qualifiers
FT   CDS_pept        56324..58066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0040"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   cth:Cthe_1334 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40430"
FT                   /db_xref="GOA:A9KQC1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQC1"
FT                   /protein_id="ABX40430.1"
FT                   /translation="MGKEDIRSEWKRDMYHNYLIFNGRGEERASFQEKMLEHNKIEGIL
FT                   SFQVHSIDNHKQFHYEVTGYQAISCISEKVPLRLSQVTMLLNHLLAVLKDAKSYLLDTK
FT                   DFVLLPEYTFIHLPDYKLGLCYYPGYHVPLQEQLVAFLEFLMGSVDYQDKEAVLFVYSL
FT                   YMKSKEDSITIQELKSFMEELEVKDKSDTLYMENGLESQGKLDKVKEPQSNREPYQSKN
FT                   TIKQPSNFNKHNEEKKNQKLKESLANPSRRNLLQYKVTSLLADTKERILGKENENGASK
FT                   KYGNQKKETKKEHKYPFVKEKLEQEEEILYYPFFCYALFAVLFIVCIGIFLYTYQKGFL
FT                   YQSLKKKIDGLKLISLLSVMGVILGYGYLKIFAKERKLSRIITRTTYQMPDKEDLFSNS
FT                   VSSEDNSLIENSYRIHKQDNNLNFNNLSNFTWENNESPMIYGEDSSSDYSGESYGSGEA
FT                   YHSGESYDEEECTILLTCPDKEYDTLIPLESTKYDTIEIKEYPFYIGTAKNNLGYSLIN
FT                   TAVSRYHAKLEKDESRFILTDLDSTNGTFVNGRKLMPNENFEIKQGDTVSFANIGFIFH
FT                   CLNK"
     gtgggaaaag aagatatccg ttcggaatgg aaacgggaca tgtatcataa ctatttgatt        60
     ttcaatggaa gaggagagga gagggcgtct tttcaggaga agatgctgga acataataaa       120
     attgaaggaa tactatcttt tcaagttcat tccatcgata atcataaaca atttcattat       180
     gaagttacag gataccaagc gatttcttgt atatctgaaa aggttcctct aaggctaagt       240
     caagtaacaa tgcttcttaa tcatctgtta gcagttttaa aagatgcaaa atcgtatctt       300
     ttagatacca aggattttgt gttgttacca gaatacacgt ttatccattt gccggattat       360
     aaattaggtt tatgttatta tccggggtat catgttccgc ttcaggaaca gctggttgca       420
     tttttagaat ttttaatggg gagtgtagat tatcaggata aggaagcggt actatttgtg       480
     tattcacttt atatgaagag taaggaagat agtatcacga tacaagaact taagtctttt       540
     atggaggaac tggaagtaaa agataaatca gatacgctat atatggaaaa tggattagaa       600
     tcgcaaggta aactggataa agtgaaagaa ccccaaagta atagagagcc ttatcaaagc       660
     aaaaatacca taaagcagcc atctaatttt aataaacata atgaagaaaa gaagaatcag       720
     aagcttaagg aatctttggc gaatccatct cgaagaaatc ttttacaata taaagtgact       780
     tctttattag cagatacaaa agaaagaata cttgggaaag aaaatgaaaa cggagcaagt       840
     aagaaatatg gtaatcaaaa gaaagaaaca aagaaggaac ataaatatcc ctttgtaaaa       900
     gaaaagctgg agcaggaaga agaaatccta tactatcctt tcttttgcta tgctttattt       960
     gcagtactat ttattgtatg tatcggaatt ttcctataca cttatcaaaa gggattttta      1020
     tatcaatcct taaagaaaaa gatagatgga ttaaagttaa tctctttact ttctgttatg      1080
     ggagtcatat tgggttatgg ttatttgaaa atatttgcga aagaaagaaa gctaagtcgc      1140
     attataacaa gaactaccta tcaaatgcca gataaggaag atttattttc taattctgta      1200
     tcttcagaag ataatagctt gatagaaaat agttatagaa tacataagca agacaataat      1260
     ctgaatttta ataatctttc taattttaca tgggaaaata atgaatcccc tatgatttat      1320
     ggagaggatt catcttctga ttattcggga gaatcttatg gctctggaga agcttatcat      1380
     tcgggagaat cctacgacga ggaggagtgc acgatactgc ttacttgccc tgataaagaa      1440
     tacgatactc ttattccttt agaatcaacg aaatatgata caatagaaat taaggagtat      1500
     ccattttata tagggactgc aaaaaataac ctgggttata gtttaattaa caccgcggtt      1560
     agtagatatc atgcaaaact tgaaaaggat gagagtagat ttatattaac agatcttgat      1620
     tccacgaacg ggacttttgt aaatggaaga aaattaatgc caaacgagaa ttttgaaata      1680
     aagcaaggag atacggtttc ctttgcaaac ataggtttta tctttcattg tttaaacaag      1740
     tag                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page