(data stored in SCRATCH zone)

EMBL: CP000885.PE400

CP000885.PE400       Location/Qualifiers
FT   CDS_pept        515021..515602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cdf:CD0628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40791"
FT                   /db_xref="GOA:A9KHC4"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHC4"
FT                   /protein_id="ABX40791.1"
FT                   /translation="MKMKQQTKWYEKLWIASSIYLILSPFNILFAWLGLLCFFIPLLIS
FT                   MFKGSKVYCNRYCGRGQLLTILGDRFKLSRNKATPRWMRSNYFRYGFLIFFLTMFVNML
FT                   MNTYYVLRGAKGLKQVITILWTFKLPWNFATYSYASSWIVQFGFGFYSIMLTSTILGLI
FT                   TMLLYKPRSWCVYCPMGTMTQGICKLKDKM"
     atgaaaatga aacaacagac aaaatggtat gagaagctat ggatagcatc ttcaatatat        60
     cttatattat caccatttaa tattttattt gcatggctag gattactttg tttttttatt       120
     cctcttttaa tttccatgtt taagggaagc aaggtatact gtaaccgcta ttgtgggagg       180
     ggacagttac ttaccatatt aggtgatcgc tttaagttat caagaaataa agcaacacct       240
     agatggatgc gttccaatta ttttcgatat ggatttttaa tattctttct tactatgttt       300
     gtaaatatgc tcatgaacac ttattacgta ttaagaggag cgaagggttt aaagcaagtg       360
     attacgattt tatggacttt taaattacct tggaattttg ccacgtattc ttatgcatca       420
     tcttggattg tgcaattcgg atttggattt tacagtatca tgttaacttc cacgatctta       480
     ggacttatta caatgctact ttataaacca aggtcttggt gtgtgtattg tcctatgggg       540
     actatgacac aaggcatctg taagttaaaa gataagatgt aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page