(data stored in SCRATCH zone)

EMBL: CP000885.PE411

CP000885.PE411       Location/Qualifiers
FT   CDS_pept        527112..528479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0415"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: lsl:LSL_0068
FT                   potassium uptake protein KtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40802"
FT                   /db_xref="GOA:A9KHD5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHD5"
FT                   /protein_id="ABX40802.1"
FT                   /translation="MFQKKRRFSTTRMIATGFLAGIMLGALLLSLPIATKAGIVTPLED
FT                   SFFTATTSICVTGLTTVTTGEHWSFFGQLVILLLIQFGGLGVVTFTTTIFLLLGKRVKL
FT                   SDRLVIQNAYNIDTLSGLVKLTKKIIKFTLIVEGIGAFCYLFQFVPEFGVVDGVWYSIF
FT                   HAVSAFCNAGIDLVGGNSFIPYRDNLWINLVTMGLIVLGGIGFPVWWDVFHISKQAVKK
FT                   DIKVRSMFRRLTLHSKIAITVTVVMIVLGAVLTFILEFNNPATIGELSIGKKMLSSLFQ
FT                   SVTTRTAGFATIPQQNFKDATSIVYLVWMFIGGSPSGTAGGIKTVTVAVILLSTISIVR
FT                   GKKDIEIFQRRISDQYLKKGLAVVMVSFLVLMVTTISLSAIQNSSFLDTLYETTSAIGT
FT                   VGLTRNMTGSLMTAGKIIVMITMYLGRIGPITMALAINAGKHQGEKSLPEGKILVG"
     atgtttcaga agaaaagaag gttttcaaca acaagaatga ttgcaactgg tttcttagca        60
     gggattatgc taggagcttt gttgctttct ttaccgattg ccacgaaggc tggaattgtt       120
     actccgcttg aagattcgtt cttcacagcg acgacatcca tctgtgtgac tggactgaca       180
     actgtaacaa caggggaaca ttggagtttc tttggacagt tagtaatcct gttgttaata       240
     cagtttggag gattgggagt tgtaaccttc acaacaacaa tattcttact tctaggtaag       300
     agagtaaaat tatcagatcg cttggtaatt caaaatgcat ataacattga taccttatca       360
     ggtctcgtaa agttaacgaa gaaaataatt aagtttaccc ttattgttga gggaatagga       420
     gctttttgtt atttatttca gtttgtccca gagtttggtg ttgtagatgg ggtatggtat       480
     tccatctttc acgcagtatc agcattttgt aatgctggta ttgatttagt tggtggtaat       540
     agctttatac catatcgtga taatctatgg attaatctgg ttacaatggg cttaattgtt       600
     cttggtggta tcggtttccc ggtatggtgg gatgtatttc acatttcaaa acaagcagtg       660
     aagaaagata ttaaggttcg ctccatgttt cgaagattaa ccttgcattc taaaattgcc       720
     attactgtta cagtagttat gatagtgctc ggggcagttt taacctttat tcttgaattt       780
     aacaatccag caaccattgg agaattatcg ataggaaaga aaatgcttag ttcgctgttt       840
     cagtcggtaa cgaccagaac tgcggggttt gcgacaattc cacagcaaaa ttttaaagat       900
     gcgacaagta ttgtatactt agtatggatg tttataggcg gatcaccttc tggtacggcc       960
     ggtggtataa agacagtaac agttgcagtg attttactat caacaatatc gattgttcgt      1020
     ggtaaaaagg atattgaaat cttccaaaga agaatatcag atcaatattt aaagaaaggt      1080
     cttgcagttg taatggttag cttcctagtg ttaatggtaa ctaccatttc attaagtgca      1140
     atccagaata gtagcttttt agatacgctt tatgagacaa cctcagccat tggtacagtt      1200
     ggtcttacca gaaatatgac aggtagtctg atgactgctg gtaaaattat cgttatgata      1260
     acaatgtatt taggacgtat tggtccgatt acgatggcac tggcgattaa tgcagggaaa      1320
     catcaaggag aaaaatcctt accagaaggt aaaatcctgg taggatag                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page