(data stored in SCRATCH zone)

EMBL: CP000885.PE432

CP000885.PE432       Location/Qualifiers
FT   CDS_pept        555968..557662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0436"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mba:Mbar_A0989
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40823"
FT                   /db_xref="GOA:A9KHF6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHF6"
FT                   /protein_id="ABX40823.1"
FT                   /translation="MFNTIRKKLIAGFSLILIIIIASTVYNMYIYNNSRTHIISIRENA
FT                   VTSYKYASEMKNNVIQVGQFLTDVSASKDTAQLKEAEEQYNSYKSNSEELASLNPEYTD
FT                   QLNALNIEVDKFYTIGKEMADTYVKSGHEVGNIMMVDFDKAADKIYAEVDEIQKKSEAA
FT                   MDDSLMTIQMHMDMNQNISTVLAIITIIIALLTAILLAGSITKPINNLLEIFKDLERGQ
FT                   GDLTSRINIKSKDELSRLARSFNTFMDSLESMMINIKKNSVRVSQGSELLSEGGMQTSS
FT                   GVVTINTHMEKMVKDTQIINTSINQITDSIYEMTQASQDSANDAQRISVEVDRVNMLAQ
FT                   ESGKLALDTKLEMENTEKISSYTIDIAEKLGNEAEEIGKIIGTIKSITDQTNMLALNAA
FT                   IEAARAGEHGRGFSVVAEEIRNLAESNSQSAKTIEDIVKNIQDMIQKTMAATMDVGGDI
FT                   KRSSTMVENVYTQLNHIIDGVKNINNRIQNIAAITEEQSASTEELSATMESINDSNTAI
FT                   TSAMQEVAASISTQTDTITGLSTTASDLNESAKQLNELVSKFKFRES"
     atgtttaata cgatacgaaa aaaacttatt gcggggtttt ctttaatatt gattattata        60
     atagctagca ctgtatataa catgtacata tacaataata gcaggacaca tatcatatca       120
     atcagagaaa atgctgttac aagctataag tacgcaagtg aaatgaaaaa caatgttatt       180
     caggtagggc agtttttaac tgatgtgagt gcatcaaaag atacggctca attaaaagaa       240
     gctgaagaac agtataatag ctataaaagt aattctgagg agcttgctag tttaaatcct       300
     gagtatacag atcagctgaa tgcattaaat attgaggttg ataagtttta tactatcggc       360
     aaagaaatgg cagatactta tgttaaaagt ggtcatgaag ttggaaatat aatgatggtt       420
     gattttgaca aagcagccga caagatatat gctgaagttg atgaaattca gaagaaaagt       480
     gaagctgcca tggacgatag cttaatgact attcaaatgc atatggatat gaaccaaaat       540
     atatctactg ttttagcgat aataactata attatagcac tcttaacagc aatactgctt       600
     gctggaagta ttaccaagcc tataaataat ctacttgaga tatttaagga tcttgagaga       660
     ggtcaaggtg atctaacaag cagaattaat ataaaatcaa aagatgaact ttctaggttg       720
     gcacgttcct ttaatacatt tatggacagt ctagagagca tgatgataaa tataaagaag       780
     aattctgtta gagtatcaca aggctctgaa ctattgagtg aaggtggcat gcagacttct       840
     tctggtgttg ttacgattaa tactcatatg gaaaaaatgg tgaaggacac gcaaataata       900
     aacacttcaa tcaaccagat tacggatagc atatatgaga tgacacaggc ttctcaggat       960
     tcggctaatg atgcgcagcg aattagtgta gaggttgata gggtaaatat gcttgcccaa      1020
     gagagtggaa agttagcact ggatacaaaa cttgaaatgg agaatactga gaaaatctcg      1080
     tcctacacaa ttgacatagc tgaaaagcta ggaaatgaag ctgaggaaat agggaaaata      1140
     ataggaacaa taaaatcaat cactgaccaa acaaatatgc tagcattaaa tgcggcgata      1200
     gaagctgcga gagcaggaga gcacggcaga ggatttagtg tcgtagcgga ggagattcga      1260
     aatcttgcag aaagcaatag ccaatcagcc aaaacaattg aggatatcgt taaaaatatt      1320
     caggatatga ttcagaagac aatggcagca actatggatg ttggtggaga tataaaaaga      1380
     agttctacta tggttgaaaa tgtatataca cagcttaatc atattattga tggagtaaaa      1440
     aatataaata acagaattca aaatattgca gcaatcacag aagagcagag cgcttcaacc      1500
     gaggagcttt cagcaacgat ggaatctatc aatgatagta atactgcaat tacatcagct      1560
     atgcaggaag tggcagctag tatatctact caaacagaca caattacagg cttaagtaca      1620
     acggcttcag atctgaacga gtctgcaaaa cagttaaatg aactggtaag taaatttaaa      1680
     tttagggaga gctaa                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page