(data stored in SCRATCH zone)

EMBL: CP000885.PE463

CP000885.PE463       Location/Qualifiers
FT   CDS_pept        596301..597020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHI7"
FT                   /protein_id="ABX40854.1"
FT                   /translation="MKVTYIYHSCFTVEEKDVVLIFDYFKGDLPKFDSEKKIYVFSSHK
FT                   HADHFSRIIFDLVKGYKNISFLLSNDIKMNEKYMERVQIPEEARDKIQNLRKNETYQIT
FT                   EDLKVETLTSTDQGVAFVVTLFGKTIYFAGDLNWWTWKGETEEEYQDMTKRFLTEIEKL
FT                   KGRHLDLAFLPLDGRQEERFYLGFDHVMREAEVINAFPMHYWEKPDVIQRLKEMEVSKD
FT                   YRDRIFDVMEPGQVFEC"
     atgaaagtaa cctatattta tcacagctgc tttacagtgg aagaaaagga tgttgtatta        60
     atatttgact attttaaagg ggacttacct aagtttgata gcgaaaagaa aatatatgtt       120
     ttttccagtc ataagcatgc ggatcatttc agtagaataa tatttgacct tgtgaaaggt       180
     tataagaata tttcattttt gttatccaat gatataaaaa tgaatgaaaa atacatggag       240
     cgggttcaaa ttccagaaga agcaagagat aaaatacaaa atttacgtaa gaatgaaact       300
     tatcaaataa cagaagatct gaaggttgaa acattaacct ctacggatca aggagtagct       360
     tttgtggtta ccttatttgg caagacaatt tactttgcag gcgatttaaa ttggtggacc       420
     tggaaaggag aaacggaaga agaatatcag gatatgacaa agcgattcct cacagaaatt       480
     gaaaaattaa agggtcgtca tcttgatttg gcatttttac cgctggatgg tagacaggaa       540
     gagagatttt atcttggatt tgaccatgtt atgcgggaag ctgaagttat caatgcattt       600
     ccaatgcatt actgggaaaa accagatgta atacagagac taaaggaaat ggaagtttcg       660
     aaagattatc gagataggat tttcgatgta atggaaccag ggcaagtgtt tgagtgttaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page