(data stored in SCRATCH zone)

EMBL: CP000885.PE466

CP000885.PE466       Location/Qualifiers
FT   CDS_pept        598623..598913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40857"
FT                   /db_xref="GOA:A9KHJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A9KHJ0"
FT                   /protein_id="ABX40857.1"
FT                   /translation="MEYSNEKNIGVIISIMILCTAGYVIQRNNRAHEDIEVIHMEVDRV
FT                   VYHNLTELMNASDLVVIGEYCQDTEQLIEYSFSNEFNKNVITDMISTISYR"
     atggagtata gcaatgaaaa aaatattgga gttattattt ccataatgat attgtgtact        60
     gcaggttatg ttatacaacg gaataataga gcacatgaag atattgaagt tattcatatg       120
     gaagttgata gggtagttta tcataattta acagaattga tgaatgcttc agatttggta       180
     gtcataggtg agtattgtca ggatacagaa caattaatag aatattcttt tagtaatgaa       240
     tttaataaga atgttattac cgatatgatc tctacaattt catatcggta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page