(data stored in SCRATCH zone)

EMBL: CP000885.PE476

CP000885.PE476       Location/Qualifiers
FT   CDS_pept        609211..610278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0480"
FT                   /product="stage V sporulation protein AD"
FT                   /note="TIGRFAM: stage V sporulation protein AD; PFAM: Stage
FT                   V sporulation AD family protein; KEGG: amt:Amet_2220 stage
FT                   V sporulation AD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40867"
FT                   /db_xref="GOA:A9KI33"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR038369"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI33"
FT                   /protein_id="ABX40867.1"
FT                   /translation="MTQTTAKQSKMVGKQSVQFSNPPAIIGCASVAGQKEGEGPLGAFF
FT                   DVIEEDPMFGQKTWEEAESKMLGMAVDVAIHNAGLKKSDIRYLVGGDLLGQLIATSFGI
FT                   ENFEIPLIGVYGACSTMGESIVVASMIIDGGFADRTLAITSSHFAGAEKQFRFPLAYGN
FT                   QRPKAASWTVTGSGAVILGHEPEKDSEFAKQFSPVMIKVKGITIGKIVDYGIKDSLNMG
FT                   ACMAPAACETIAQNLKDFSIQPDYYDRIITGDLGMIGKDILIDLLKEKGYDISSNHMDC
FT                   GIEIFDSEAQDTHAGGSGCGCSAITLTGYILQKLRKRDWNRVLFVPTGALLSTVSYNEG
FT                   QSVPGIAHAVMLESC"
     atgactcaaa cgacagccaa acaatcaaag atggtaggga aacaaagcgt acaattttca        60
     aatccacccg ctattattgg atgtgcctcc gttgctggac aaaaagaggg cgaggggcca       120
     ttgggtgcat tttttgatgt aatagaagaa gatcctatgt ttgggcaaaa aacgtgggaa       180
     gaagcggaga gtaagatgct tggaatggca gtagatgttg caattcacaa tgcaggacta       240
     aaaaaatcag acatacgtta cttagttggt ggagacttgt tgggacagtt aattgctacc       300
     agctttggta ttgagaactt tgaaatacca cttataggtg tttatggtgc atgttccact       360
     atgggagaat caattgtggt tgcctcaatg attattgatg gtggatttgc tgacagaact       420
     ctagcaatca catcaagcca ttttgctggg gctgaaaaac aattccgatt tcctctcgcc       480
     tatggtaatc aaaggcctaa ggcagcatct tggacagtaa caggaagcgg tgctgttata       540
     ttaggtcatg aaccggaaaa agatagtgaa tttgcaaaac aattttctcc ggtaatgata       600
     aaagtgaagg gtattacaat tggtaaaatt gttgattatg gaataaaaga ctctttaaat       660
     atgggtgctt gcatggcacc agcagcatgt gaaacgattg cgcaaaattt aaaggatttt       720
     agtattcagc cagactacta tgatcgtatt ataaccggtg atctaggtat gattggtaag       780
     gatattctaa tcgatttact aaaggaaaag ggatatgaca taagtagcaa tcatatggat       840
     tgtggtattg aaatctttga ttctgaggct caggatactc atgccggtgg tagtggttgt       900
     ggttgtagtg caattacttt gacaggatat attttgcaga agttaagaaa acgggattgg       960
     aatagggtct tatttgtacc aactggtgca cttctttcta cggtaagcta taacgaggga      1020
     cagagtgttc ctggaatcgc acatgcagtg atgttggaat cttgctag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page