(data stored in SCRATCH zone)

EMBL: CP000885.PE479

CP000885.PE479       Location/Qualifiers
FT   CDS_pept        612076..612411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0483"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ppr:PBPRB1735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40870"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025499"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI36"
FT                   /protein_id="ABX40870.1"
FT                   /translation="MAVYKELDSKYEVLVEGKSGRRIKGYDGSLMMVEVYFENHYISEK
FT                   HTHEHEQMTYCLEGTFEFYIGDKVERISAGDTIYFPSNIEHHCAVITETGRLLDVFTPI
FT                   RKDFIQE"
     atggcagtat ataaagaact agacagcaaa tatgaagtat tggtagaagg taaatccggt        60
     agaaggataa aaggctatga tggctcatta atgatggttg aagtttattt tgagaaccac       120
     tatatttcag aaaaacacac acatgaacat gaacaaatga cctattgttt ggaaggaaca       180
     tttgagtttt acataggtga taaggtggaa agaatcagtg cgggtgatac aatttatttc       240
     ccttcaaaca tagaacatca ttgtgcagta ataacggaaa caggaaggtt attagatgtt       300
     ttcactccga tacgcaaaga ttttatacag gaataa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page