(data stored in SCRATCH zone)

EMBL: CP000885.PE484

CP000885.PE484       Location/Qualifiers
FT   CDS_pept        617267..619552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0488"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   atc:AGR_L_3558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40875"
FT                   /db_xref="GOA:A9KI41"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012364"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032518"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI41"
FT                   /protein_id="ABX40875.1"
FT                   /translation="MTKLIEPKSSILTIGYHPENEKILENPPRFTWMPESEKDILYRIQ
FT                   VSKNDTFDPDSTLTIHHIPYNFYTLDKELEPGDYYWRYTIDQEECSYSKVRKLSISDGL
FT                   VVTPLVSREKRYDNVDMSHPRIWLNKEKIDMFREELEKNPNYCGFQIFLERSVLIHVNS
FT                   EFVAEPPFYPGNIRVVELWRKNYQECQRGLEYIRSLSVAGVLLENSEYIEKAKLALLKL
FT                   ASWDTNGSTARDYNDECSFRVAYALAFGYDWLYSFLTKQERSIILESLSVRTRQVATHI
FT                   IKDSRIHLSLYDSHAVRSLSSVLTPCCIAMLGESAEAKEWLDYTIEYFNTIYTPWGGED
FT                   GGWAEGGLYWTTGMAFVSEALNTIKSFLNIDIYKRPFFQKTGDFPLYCMPVDTYRASFC
FT                   DQSNLGKYPGHKTAYNIRQFAGVTGNQNYQWYYEQVLEREKEIDQDFFNKGWWDFYFDD
FT                   MVYRHDYKDTTLKEEKLERVKWFKDIGWVAINKDMKDPKEHIFLLTKSSPYGSVSHSHG
FT                   DQNSFVLFAYGEPLIIKSGYYIGFNTTMHRNFRRQTLSHNSILINGKGQYAGMDKAKQL
FT                   SAKGHICEVKESDNLVYIKEDATAAYQLTAPELTKYTREIYFVDDSYFILVDTVESEDK
FT                   SDVEWLLHSLSKFQIEEETIEVNGKMAGMTAKIVYCSSNIESITQSDIFTEVDEKETDG
FT                   LDNQWHLTMKTGKAKKHIIVSVIVPYKMEQKKLVNSVRDDQGMDIYLYFSYEGKTFSLC
FT                   IDGTKRNE"
     atgacaaaat taatcgagcc caaaagttca atcttaacaa taggatatca tccggagaat        60
     gaaaaaattc tggaaaatcc acctagattt acgtggatgc cagagagtga aaaggacatt       120
     ttatatcgaa tccaggtatc aaaaaatgat acgtttgatc cggattccac attgactata       180
     catcatatcc catataattt ttatacatta gacaaagagc ttgaacccgg tgattattac       240
     tggagatata ccatagatca agaggagtgt tcttatagta aggtccgtaa gttatcaata       300
     tcggatggtt tagtagttac accacttgtc agtagagaaa aaagatatga taacgtggat       360
     atgtcgcacc cacgtatctg gctaaataaa gagaaaatag acatgtttcg cgaggaatta       420
     gagaaaaatc ctaattattg tggattccag atttttcttg aaaggtcagt attaatacat       480
     gtaaattcag aatttgtggc agagcctcct ttttatccag gaaatattag agtggtagag       540
     ttatggagaa agaattatca agaatgccag agagggttag agtacataag atccttaagt       600
     gttgcgggtg tattgcttga aaatagtgaa tatattgaga aagcaaaact tgctttgctt       660
     aaactggcct cgtgggatac caatggttct acagcaagag attataatga tgaatgttca       720
     tttcgtgttg cctatgcctt agcttttggt tacgactggc tgtattcctt cttaacaaaa       780
     caggaaagga gtatcattct tgaatctttg agtgtacgaa ccaggcaagt ggcaactcac       840
     atcatcaaag attccagaat tcatctttcc ctttatgaca gccatgcggt tcgatcgctt       900
     tcttctgtac tgactccatg ctgtatagca atgcttggag aatctgcaga agctaaggaa       960
     tggcttgatt ataccattga atactttaac accatttata cgccatgggg aggcgaagat      1020
     ggcggttggg cagaaggcgg actttactgg acgaccggaa tggcgtttgt ttcagaagca      1080
     ctaaatacaa ttaagagctt tttaaacatt gatatctata aacgtccgtt tttccaaaaa      1140
     actggagatt ttccgcttta ttgtatgcct gtcgatactt atcgtgcaag tttttgtgat      1200
     caatcaaatc tgggaaaata tcccggacat aagactgcct ataatatcag acaatttgca      1260
     ggggtgactg ggaatcaaaa ttaccaatgg tattatgagc aggtactaga gagggaaaag      1320
     gaaatagatc aggacttttt taataaggga tggtgggatt tttattttga tgatatggta      1380
     tatcgccatg actacaaaga cacaacactg aaagaggaaa aactggaacg agtaaaatgg      1440
     ttcaaagata tcggatgggt agcaatcaat aaagatatga aagacccaaa ggaacatatc      1500
     tttttattaa ctaagagcag tccttacggt tctgtcagcc atagtcatgg agatcagaat      1560
     tcctttgtgc tattcgctta tggagaaccg ctaattatta aaagcggata ctacattggt      1620
     tttaatacga cgatgcaccg aaattttcga agacagacac tttctcataa ctctattctc      1680
     attaacggca aaggtcagta tgccgggatg gataaggcaa aacaacttag cgcaaagggg      1740
     catatttgcg aagtcaaaga aagtgacaac ttagtttata tcaaagaaga tgcaacggcg      1800
     gcataccagc tgacagcacc tgagctaaca aaatacacaa gagaaattta ttttgtggac      1860
     gattcttact ttattcttgt tgacacagta gagtcagaag ataaatcgga tgtagaatgg      1920
     ctgcttcata gcctaagtaa atttcaaatc gaggaagaaa caatcgaagt aaatggaaag      1980
     atggcaggaa tgacagcaaa aatcgtatat tgttccagca atattgaatc gataactcaa      2040
     agcgatattt ttaccgaagt cgatgaaaag gaaacggatg ggcttgacaa ccaatggcat      2100
     ctgactatga aaacagggaa agcaaagaaa catattattg tatcagtaat tgtcccatat      2160
     aagatggagc agaaaaaatt agtaaatagc gtaagagatg atcagggaat ggatatttat      2220
     ttatatttta gttatgaagg taagacattt tccctatgta ttgatggcac taagcggaat      2280
     gagtaa                                                                 2286
//

If you have problems or comments...

PBIL Back to PBIL home page