(data stored in SCRATCH zone)

EMBL: CP000885.PE488

CP000885.PE488       Location/Qualifiers
FT   CDS_pept        623046..627716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0492"
FT                   /product="Alginate lyase 2"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Ig domain protein
FT                   group 2 domain protein; Alginate lyase 2; KEGG:
FT                   pau:PA14_41500 putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40879"
FT                   /db_xref="GOA:A9KI45"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI45"
FT                   /protein_id="ABX40879.1"
FT                   /translation="MGCRHSKLRRITALIVLIAIVITGMPNTVHAQDKTYIMYQIKDGD
FT                   TIKKIADRYNTSIDSIMKLNNIKNSNVFYSGKETKVPIASVTYVVKKGDTLSKIARTHG
FT                   TTVDTIAKLNGIKDENKIQTGQKLIVVKEEHVESTTSVNNEETLVRTQKELLNALASKS
FT                   STVIRIATEKKITFEIPKKNYNAKVLIVDAKNSEVKNEGTFHHILIQAIKTSTFYEYGS
FT                   KNTIIIKASTAHLVMEKTAVPGKIIVEDTNKELTIDNYTKKQMTLQTSDTVLTVKAENS
FT                   VEVKQGIVKKESKLNQIKPTVAPTTKPTAVPTTKPTVVPTITPTGTPNPTTAMPEPTSI
FT                   PTDIPTPVPTTIPPTNVPTISPTPIPQLPSDIVDFSTWKLQLPIAGESGLSVKEVGPED
FT                   LNNGFVHDEYFYVDTDGGIVFHCPVDGFKTANTNYARTELREIIDGKNPAVNWGFQGTH
FT                   ILRTSESVEKVSSNGRTVVSQIHGIYPNGDNGPVLVKVQYEHDLKAVVVMLKTGTAPNA
FT                   AEQRGYFYGVELGQRFETEIKCVEGVLYVTIQSEGRKETYTINFMEMDPTWGGQLGYFK
FT                   VGNYIQDSDVNYENEAATVKVYSIETFHDDSYVEQVPIEGLAMKQTEVTLDVGETIGLE
FT                   PVFTPVDTTNKAVTWNVVSGQNKVAVNKHGVVTAIAEGEAIVRATSKENNSVFAECVLT
FT                   VTLDSKQEVIALYEQDFGKDMPYDIANASEWLLSTTGYGKVEVEQEGDNFILKLTDTDM
FT                   AGTAKSLVYFPEQYGTTTLSYRIRVDEILVKDPEGAKAQASYLYLPVGGQDGFMNAADE
FT                   MFRIRNGATYQGGTLINHRWQLSHSYSDATMNYAATEFKIGEWKEITVVITPDNGTANA
FT                   NKTDVYVDGYRVASQMNNNKINSYINQAEFYTGTKDQVSFSIDDVRIYSGEKVREAEDA
FT                   LPPTSITLGTAPSTMATGDSFKLTTYITPADAKEAVTYLITSGADLVSVSKDGLVTAIK
FT                   PGTATVRVHSTGHEEIFSEITLTIVEESSIVRVESIELPEKIINLAEGEEKQLFPILLP
FT                   LNATEQKVSYEVIHGFDVISVSAEGILSTKNTGVATVRITCMDNSRLYVDCDISVTRKT
FT                   NEGTVIFRDTFDETLDLTKWTLATSNFNDTITEVKDGSLHLVDNNTSGQPRAYVSFEPQ
FT                   ASTFSIEFKVKMSADTIYNSNKVSALCVAFGTGTITSTASETFRFKTSADVANGEVTNR
FT                   RFVYSKEEGASGFYDLSKNYELEEWYTVKLVTTPNDGSTRANTTDIYINDTLMIEGAAN
FT                   KTNAAIIDKLIFQTGTADLTEFWIDDVTITAGNSSSETPGENPGYQLVYEEDFENGSLP
FT                   EASSTTNPSIRPSWKLTTGESSLSEIALDTIDNSALKLFDSDTSSQPKAQLIFNPITDK
FT                   ATIEFRLKMESDKVYIDGTNQKASAFCVVFGSTSDGNIATKANEMFRFKTTATVDTASG
FT                   SAISYRKYQYENSDGKSFVTLDAPSYELNTYYTIKFVITLGDTQKTEIYIDGVKVAEGY
FT                   HKKNTNTVDTILFQSGSMDLTNYWIDNVKIYQGHNV"
     atgggatgta gacatagtaa gttaagaagg ataacagcac taattgtatt gatagccatc        60
     gtaattactg gtatgcctaa taccgtccat gcacaagata aaacttatat aatgtaccag       120
     ataaaagatg gggatacaat taagaaaata gctgatcgat acaatacaag cattgacagc       180
     attatgaaat taaataatat aaaaaattca aatgtatttt attccggaaa agaaaccaag       240
     gtaccgatag cctcggtaac ttatgtggta aaaaaaggag atacactttc aaagatagcg       300
     agaactcacg gtaccacagt tgatactatt gcgaaattaa atggaatcaa agatgaaaat       360
     aagatacaaa caggccaaaa acttatcgta gtaaaagagg aacatgtaga gagtacaact       420
     tctgtaaaca atgaggaaac cttagtaaga acacagaagg aattattaaa tgcccttgca       480
     tcgaaaagtt ctacggtgat tcgaattgct actgaaaaaa agattacttt tgaaattcca       540
     aaaaagaatt ataacgcaaa agttttgatt gtagatgcga aaaattcgga agttaagaac       600
     gaaggaacat ttcatcatat attaattcaa gccattaaga catcaacctt ttatgaatat       660
     ggcagtaaga ataccattat tataaaagct tctacagcac atttggtaat ggaaaagacc       720
     gctgtacctg gaaagattat tgtggaagat acgaataaag agcttactat cgataactat       780
     acgaagaagc agatgacact tcagacgtca gatacagtat taacagtaaa ggctgaaaat       840
     tcggtggaag tgaaacaagg tatcgtaaag aaggaaagca agttgaatca aataaaacca       900
     acagtagcac caactacgaa gccgaccgca gtacctacta cgaaaccaac cgtagtacct       960
     acaattactc caactggtac tccaaatcca actactgcta tgccagaacc aacgagcata      1020
     ccaacggata taccgacacc ggtgccgaca acgataccgc cgactaatgt accaacaata      1080
     agtccgacac caataccaca gctaccttct gatattgttg atttttcaac ctggaaatta      1140
     caacttccga tagcaggaga atctggttta tcagtaaaag aagtaggccc tgaggactta      1200
     aacaacggtt ttgttcatga tgaatacttc tatgttgata cagatggtgg tattgtgttc      1260
     cactgccctg tggatggatt taagacagca aacacgaatt atgcgagaac cgagcttcga      1320
     gagattatcg atggaaaaaa tccagcggtg aactggggat ttcaaggaac ccatatttta      1380
     aggaccagtg agagtgttga gaaagtatca tccaatggaa ggactgtagt ttctcagatt      1440
     catggaatct atccaaacgg tgataatgga ccggtgctag ttaaggtaca gtatgaacat      1500
     gatttaaaag cggttgttgt tatgttaaaa acaggaacag cgcctaatgc tgcagagcaa      1560
     aggggatatt tttatggtgt agaattaggc cagcgctttg aaactgaaat taaatgtgtg      1620
     gagggtgttt tatatgtaac catccaaagc gaaggaagaa aagagaccta taccattaac      1680
     ttcatggaaa tggaccctac atggggaggg cagcttggtt atttcaaagt aggaaactac      1740
     atacaggata gtgatgtaaa ttatgaaaac gaggctgcta ctgttaaggt ttattccatc      1800
     gagacatttc atgatgactc ttatgtggag caggttccaa ttgaaggact tgcaatgaaa      1860
     cagacagagg tgaccttaga tgttggtgaa accatcggat tagaacctgt ttttacacca      1920
     gtggacacca cgaataaggc agtaacttgg aatgtagtca gcggacagaa taaggtagcg      1980
     gtgaacaagc atggagttgt tactgcaata gcagagggtg aagcaattgt tagagcaact      2040
     agcaaagaga ataacagtgt ttttgctgag tgcgtcttga ccgtaacatt agattcgaaa      2100
     caagaggtaa ttgctcttta tgagcaggac tttggtaaag atatgcctta tgatatcgct      2160
     aatgcaagtg agtggctact tagcacgaca ggatatggta aggtggaagt agaacaagag      2220
     ggagataatt ttatattaaa gctaaccgat acggatatgg ctggaacagc aaaatccttg      2280
     gtttattttc cagagcaata tggaactact acgcttagct atcggattcg agtggatgaa      2340
     attttagtaa aagacccaga gggagcaaaa gctcaggcat cttatctcta cttaccagta      2400
     ggaggccagg atggtttcat gaatgcagcg gatgagatgt tccgtattag aaatggtgca      2460
     acttatcaag gaggaacact aattaatcat cgttggcagc tatcccactc ttattcggat      2520
     gcaacaatga attatgcagc taccgagttt aagattggag aatggaaaga aatcacggtc      2580
     gttataacac ctgataacgg tacagcaaat gcgaataaaa ctgatgtcta tgtagatggc      2640
     tatcgagtcg caagtcagat gaacaacaat aagatcaata gctatattaa tcaagcagag      2700
     ttttatactg gtacgaagga tcaggttagt ttcagtattg atgatgtgag aatttactcc      2760
     ggagaaaaag taagggaagc agaagatgct ctgccaccaa cgagcattac ccttggaact      2820
     gcaccatcta cgatggcaac tggtgactcc tttaagctta caacatacat tacaccggca      2880
     gatgccaaag aagcggtaac ttatctaatt acaagtggag cagacctcgt atctgtaagt      2940
     aaggatgggt tggtaacagc aatcaagcca ggaactgcaa ccgttcgtgt acacagtacc      3000
     ggacacgaag aaatcttttc agaaattacg ctaactatcg tggaggagag ctctatcgta      3060
     cgtgtagagt ccattgagct acctgaaaaa atcatcaatt tagcagaagg agaagagaaa      3120
     cagctatttc caatcctact tccgctaaat gcgacggagc aaaaggtaag ctatgaagtg      3180
     attcacggtt ttgatgtaat tagtgtttct gcagaaggta tcttaagtac taagaataca      3240
     ggtgtcgcta ctgtgcgtat tacatgtatg gacaacagcc gattgtatgt agattgtgat      3300
     atttctgtta caaggaagac aaatgaggga acagtgatat ttagagatac gtttgatgaa      3360
     acactggact taacaaaatg gacactggct acctctaatt ttaacgatac aatcacggaa      3420
     gtaaaggacg gatcacttca tctggtagat aacaatacaa gtggtcagcc aagagcctat      3480
     gtctcttttg aaccacaggc ctcaaccttt agcatcgagt ttaaggtaaa aatgtctgct      3540
     gataccatat acaactcgaa caaagtatct gccctatgtg ttgcatttgg tactggtacg      3600
     ataactagta cagcaagtga aacattccga tttaaaacct ctgctgatgt ggcaaatgga      3660
     gaagttacga atcgtaggtt tgtatatagc aaggaagaag gcgctagcgg attttatgac      3720
     ttgagtaaga actatgaact ggaggagtgg tatactgtaa aattagtgac tacaccaaac      3780
     gatggttcta cgagagcgaa tacaacagat atctatatta acgatacatt aatgatagaa      3840
     ggtgccgcga ataaaacaaa cgccgccatc attgataaat taatattcca aacaggaaca      3900
     gccgatttaa cagagttctg gattgatgat gttacgataa cagctggtaa ttctagtagt      3960
     gaaacacctg gtgaaaatcc aggataccaa ttagtatacg aagaagattt tgaaaatggc      4020
     tctttaccag aagcaagttc cactacaaac ccttccattc gtccatcgtg gaagcttacg      4080
     acaggggaaa gctctctctc tgagatagct cttgatacaa tagacaattc tgcactgaaa      4140
     ttgtttgatt ctgatacgag cagtcaacca aaggcacaac ttatatttaa ccctatcacc      4200
     gataaggcaa cgattgaatt tcgcttaaaa atggaaagtg ataaagttta tatcgacgga      4260
     acgaatcaaa aagcttctgc attttgcgtt gtgtttggtt ctacttcgga tggaaatatt      4320
     gcaacaaaag cgaatgaaat gttccgattt aaaacaaccg caacagtaga tacagcctct      4380
     ggctctgcaa tttcttatcg taagtatcaa tatgaaaatt cagatggaaa atcctttgta      4440
     acattggatg caccgagcta tgaattgaat acttactaca caataaaatt cgttattacg      4500
     ttaggagata ctcaaaagac agagatttat attgatggag tgaaagttgc agaaggttac      4560
     cataagaaga atacgaatac ggttgatacg atattatttc aaagtggatc aatggattta      4620
     acaaattatt ggattgacaa tgttaagatt tatcagggtc ataatgtata a               4671
//

If you have problems or comments...

PBIL Back to PBIL home page