(data stored in SCRATCH zone)

EMBL: CP000885.PE501

CP000885.PE501       Location/Qualifiers
FT   CDS_pept        646539..647039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bth:BT_4765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40892"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI58"
FT                   /protein_id="ABX40892.1"
FT                   /translation="MPNIAIMKISTYHKAQGHDVDWYNPVIDIMDTDILYECQLFNFTA
FT                   PYQYYPVRAKIIRGGTGVDIKSHLPKEIEQILELDYSLYPDCDYSMQFFSRGCIRNCHF
FT                   CVVRDKEGYIHEVEPMLLNPKGKHIEVLDNNFFANPNWNKAVDYIINTGQKVSLHGVDY
FT                   GYL"
     atgcctaata ttgcgatcat gaaaatatct acatatcaca aagcacaggg gcatgatgtt        60
     gattggtata accctgttat agatattatg gatacagaca tcttgtatga gtgccaacta       120
     tttaatttca cagctccata tcaatattat cctgtaagag caaagataat aagaggtggt       180
     acaggagtag atatcaagtc acatttacca aaagaaatag aacagatact agagcttgat       240
     tatagtctgt atccagattg tgattactcg atgcagtttt tcagtcgtgg atgtatcagg       300
     aattgtcatt tctgcgtagt gagagataaa gagggatata tacatgaggt tgagccaatg       360
     ctgcttaatc caaaaggaaa gcacatagag gtattagata ataatttctt cgctaatccg       420
     aactggaata aggctgttga ttatataatc aatactggtc aaaaagtgag tttacatggt       480
     gtggactatg gatatttata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page