(data stored in SCRATCH zone)

EMBL: CP000885.PE510

CP000885.PE510       Location/Qualifiers
FT   CDS_pept        655666..656220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0514"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: cbe:Cbei_1302 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40901"
FT                   /db_xref="GOA:A9KI67"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI67"
FT                   /protein_id="ABX40901.1"
FT                   /translation="MTDEEILSLINKKNQLGLSLLAEKYEKLLVYIAAGILGNHVRDIE
FT                   ECVNDTYFKFWKNAEKYDYTKASLPTYLKVIVRNTAINRLRDVRRHEDRTHSEDVAELA
FT                   SVLPDVSVNIENQMLRKENVKRLNKMIASLPEKDRELMIRKYYYVQSSKVIAHAMSMSV
FT                   TAVDSRLSRLRTKMKNEYQLT"
     ttgaccgatg aagaaattct ttctctgatt aataagaaaa atcaactggg actctccttg        60
     ttagcagaga agtatgaaaa actgctagta tatatcgctg ctggtatcct tggaaaccat       120
     gttagggata tagaggaatg tgttaacgat acgtatttta agttctggaa gaatgcagag       180
     aaatatgatt atacgaaagc ctcgttgcct acctatctta aggtgattgt cagaaacacc       240
     gcgatcaatc gtttgcgtga tgtgaggagg cacgaagacc ggacacattc cgaagatgta       300
     gcagagcttg catcggttct tcccgatgta agtgtgaaca ttgaaaatca aatgttacga       360
     aaagaaaatg taaagaggct aaataaaatg attgcaagtc tcccagagaa agatcgggaa       420
     ttaatgataa gaaaatatta ttatgtgcaa tcctccaagg taatagcaca tgctatgagc       480
     atgtctgtta cagcagtgga tagtaggtta tcacgtttac gaacaaaaat gaaaaatgaa       540
     tatcagttaa cttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page