(data stored in SCRATCH zone)

EMBL: CP000885.PE523

CP000885.PE523       Location/Qualifiers
FT   CDS_pept        669186..670076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0527"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120664 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40914"
FT                   /db_xref="GOA:A9KI80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI80"
FT                   /protein_id="ABX40914.1"
FT                   /translation="MKKKMSKEALAAILFLAPSFLGFLVFFLFPVLFSLILSFAKWDMA
FT                   SGISSIKFVGLKNFKIIFKDLWFTDSMKNSIVFTVTTVVIGVSIALILAVILTRAAYFK
FT                   NTLKAMMFLPYISSTVAIAIVWMIVLQPKYGPVNQFLLSIGVNKPPNWLADMKWAMPAL
FT                   IAMYIWQNLGYNMVVYIAGLSSVPTDLYEAAEIDGAGAFSKFRFITIPMVSPTTFFLVI
FT                   MGIINSFKVFDQVNVLTQGGPGTSTTVLALYIYREAFKFYDMGSASSAAWIMFVIIFIV
FT                   TIIQWIGQRKWVTYE"
     atgaagaaaa aaatgagtaa agaagccctg gcagccatac tttttctagc acctagtttt        60
     ttgggctttt tagtcttctt tttatttcca gtcctgtttt ctctaatttt aagttttgca       120
     aaatgggata tggcatcggg tatcagcagc ataaagtttg tcggattaaa aaacttcaaa       180
     attattttta aagatctctg gtttacggat tctatgaaaa atagtattgt gtttactgta       240
     acgactgtgg taattggagt ttccatagcc ttaattcttg cagtaattct aacgagagca       300
     gcttatttta agaatacgct aaaggctatg atgtttttac cgtatatatc aagtactgta       360
     gcgattgcaa ttgtatggat gattgttttg caaccgaagt acggaccagt aaatcaattt       420
     ttactcagta ttggggttaa taagccacca aactggttag ctgatatgaa atgggcaatg       480
     cctgcattga ttgcgatgta tatatggcaa aacttaggtt ataacatggt ggtctatatc       540
     gctggtctta gttctgtacc tactgattta tatgaagcag cggaaattga tggggcaggt       600
     gcgtttagta aatttaggtt tattactatt ccgatggtat cgccgactac tttcttttta       660
     gttattatgg gaattattaa ttcctttaag gtatttgatc aggtcaatgt tcttactcaa       720
     ggaggtcctg gaacctctac tactgtactt gctttatata tctatagaga agcttttaaa       780
     ttctatgata tgggcagtgc tagttctgca gcttggatta tgtttgttat tatctttata       840
     gtaactataa tacaatggat tggtcagaga aaatgggtaa cctatgagta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page