(data stored in SCRATCH zone)

EMBL: CP000885.PE54

CP000885.PE54        Location/Qualifiers
FT   CDS_pept        73980..75317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40445"
FT                   /db_xref="GOA:A9KQD6"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQD6"
FT                   /protein_id="ABX40445.1"
FT                   /translation="MKRLQKLFVAICVMFAIMLTQVVTVSAAQTMTFDDLYMTLEISDD
FT                   FIVLTPDTPKNDGRWAAAGIIQIDSKLKEFNDMGVKVLFYDKKSNTSVTMMVKDSSKTR
FT                   EIVNLVSMTDTELQEYFDSLVGKDSDTFVSTVEEYTHKQTPYFKLRLQSKEGESPVSEV
FT                   VYGTIMNGKSIGFDIYKEGSYIQDKEEELVRSLVDNVSFTKILDASEITKESEIGIKDF
FT                   ITPILFILIIGVILFIFNKKNKKASQIKKKISQDMQEYRLNRRKLEEAGELTKEEALFT
FT                   NSTEYHDQAIKTYCMYNQFFKRIGFWIYVIVLYLIILGYSLFFGTSIWMTIIVTIAGIV
FT                   YGYYQGIAVEKMSEAMKKKYEGSRSKNAITKFYDDYFTVSGIQYISDFPYVQVTEVRKS
FT                   KNYIYLYLGSEIAYFVDVTTFNKLEEENFMIFLKQRMGDKLKFKIR"
     atgaagagac ttcaaaaatt atttgttgct atatgtgtaa tgtttgccat catgcttact        60
     caagtagtaa cggtatcagc ggcgcaaacg atgacgtttg atgatttgta tatgaccctt       120
     gaaatttccg atgatttcat tgtgttaaca ccagataccc caaaaaacga tgggcgttgg       180
     gctgcggctg gtatcattca gattgattca aagttaaagg aatttaatga tatgggtgta       240
     aaagttttgt tttacgataa aaaaagcaat acatccgtga ctatgatggt aaaggactct       300
     tcaaaaacca gagaaatagt gaacctagtt agtatgacgg ataccgagct tcaagagtat       360
     ttcgattctt tggtaggaaa agactcagat acattcgtat ctaccgttga ggagtataca       420
     cacaagcaaa ccccatactt taaattgcga ctacaatcga aagagggaga aagtccagtc       480
     agtgaagtag tctatgggac cataatgaat gggaaaagta tcggttttga tatctataaa       540
     gagggaagtt acatacaaga taaggaagag gaattagtta gatctctggt agacaatgtt       600
     tcatttacga agatattaga tgcgtctgag attactaaag aatcagaaat aggtattaag       660
     gattttatta ctccaattct attcatatta attattggtg ttattctttt tatattcaac       720
     aagaagaata agaaagcttc tcagataaag aagaaaattt cacaggacat gcaggagtat       780
     agacttaatc gaagaaagct tgaggaagca ggagagctaa caaaggaaga agcactgttt       840
     acgaactcaa cagaatatca tgatcaagcc ataaagacat actgtatgta caatcaattc       900
     tttaagagga tagggttctg gatctatgtt attgtattgt atttgataat actgggatac       960
     agccttttct tcggtacttc aatttggatg accattattg ttacaatcgc aggtatagta      1020
     tatggttatt atcaaggaat tgctgttgaa aaaatgagcg aagcaatgaa aaagaaatat      1080
     gaaggtagtc ggtctaagaa tgcaattact aagttttatg atgactattt tacggtaagt      1140
     ggaattcaat atattagtga ctttccatat gttcaagtaa ctgaggtaag aaaatctaaa      1200
     aattacattt atctttatct aggttccgag attgcctatt ttgtagatgt gacaacattt      1260
     aataagctag aagaagaaaa ctttatgatt ttcttgaaac aaagaatggg tgataagtta      1320
     aagtttaaaa tacgctaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page