(data stored in SCRATCH zone)

EMBL: CP000885.PE542

CP000885.PE542       Location/Qualifiers
FT   CDS_pept        702304..704553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0546"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: amt:Amet_0212 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40933"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A9KI99"
FT                   /protein_id="ABX40933.1"
FT                   /translation="MKIGIVADLNDMNLDVWLSTYALQEALKEMEHISVVIHHSFINSE
FT                   DGEKLGPKELAYEFYNVVEGSSQLSNDAGYYNLFDIYLVASERMWQKVKDNTIKEYYPI
FT                   HYLRDSILLMQQKNYHPLAKKKSINEDYLLCYYETPSKEKLEFLKFLLDKKSLKLVSNQ
FT                   MGNNELKSLQSYTDQDIREFLLYLRHAKVVITDSGFIASMALLYEKPFLLLSEKTQEVL
FT                   AAGILKELGLSSLILSDLSTSRDISIYNSLLETYENNQREFRKRIKDFRKEQKKKLSQL
FT                   IRLASYEMYVDCPTDIKKIECCGCTACREVCPYNAIEMKPDEEGFIYPVVDHDKCVKCM
FT                   LCKKVCVKRENPQTITYEKRENQQTNNNVKKENPQTDTSVRKESSQTNTSARKESSQTN
FT                   TSVRKENSQTNTYAKKENFQTFTNEKKENPQTITYAKKENSQAISHAESYPIVYAVNNK
FT                   KLKVRTNSSSGGIFPELVQYVIEELEGYVVGVKFDNDMNAVSSIAHTMEEAKEFYGAKY
FT                   TKSDFTGMFRNVKKLLDKGETVLYSALPCEAAGLRAFLRKRYDNLIVSEVLCHAGPSPL
FT                   VFRRYVQYLESRFHSKVKKINFRDKSKGWLALDNTMVVEFANREPLKLRARRNNYYRSF
FT                   IKDNIARPACSQCSFVYTNRVGDLTMGDFWGIQYAKPEMFDNKGTSILMINTKNGENIW
FT                   NKISNRFEYEESNLTEAFRYNHKKPIKLTEKRNEFFDRFEKEEINSLLQEFNDLK"
     atgaaaatag gaattgtagc agatctaaat gatatgaatt tagatgtttg gttgtctact        60
     tatgctttac aagaagcgtt aaaagaaatg gaacatatat cagttgtaat tcaccattcc       120
     tttataaata gtgaggatgg agaaaagcta gggccaaaag agcttgccta tgagttttat       180
     aatgttgtgg aaggaagttc acagcttagt aatgatgctg gatattataa tttattcgat       240
     atttatcttg tggcaagtga gagaatgtgg cagaaggtaa aagataatac aattaaagaa       300
     tattatccaa tccattattt acgagattct atcctcttaa tgcaacaaaa aaactatcac       360
     ccacttgcta agaagaaatc aattaacgaa gattatcttc tctgctatta tgagactcct       420
     tccaaggaaa aattagagtt tcttaagttt cttttggata aaaagagcct taagctagta       480
     tcaaaccaga tgggaaataa tgaacttaaa agcttacaaa gctatacaga tcaagatatc       540
     agagaattct tactctatct acgtcatgcc aaggttgtaa ttactgattc gggatttatt       600
     gcctctatgg ctcttctata tgaaaaacca ttcttattac tatcggaaaa aacacaggag       660
     gttttagcag caggaatctt aaaggaatta ggattgtcta gccttatcct ttccgattta       720
     tctacatcga gagatattag tatctataac tctttgttgg aaacttatga aaataatcag       780
     cgggaattta gaaaacgcat caaagatttt agaaaagaac aaaagaaaaa attaagccaa       840
     ttaataagat tagccagtta tgagatgtat gttgattgcc caacggatat taaaaagatt       900
     gagtgttgtg gatgcacagc ttgtagagaa gtatgtcctt ataatgcgat tgaaatgaag       960
     ccggatgagg aaggatttat ctatccggtt gtggatcatg ataagtgcgt caaatgtatg      1020
     ctttgtaaaa aagtctgtgt aaaaagagaa aatccacaga cgattactta tgaaaaaaga      1080
     gaaaatcagc agacaaataa taatgtaaaa aaagaaaatc cacagacgga tactagtgta      1140
     agaaaagaaa gttcacagac gaatactagt gcaagaaaag aaagttcaca gacgaatact      1200
     agtgtaagaa aagaaaattc acagacgaat acctatgcga aaaaagaaaa ttttcagaca      1260
     tttactaatg aaaaaaaaga aaatccacag acgattactt acgcaaaaaa agaaaattca      1320
     caagcgattt ctcatgcaga aagttatccc atagtatacg cagtaaataa taaaaagctt      1380
     aaggtaagaa ctaatagttc ttctggtggt atcttcccag aattggttca atatgtaata      1440
     gaagaattag agggatatgt agttggtgtt aagtttgata acgatatgaa tgcagtttct      1500
     tcgattgcac acaccatgga ggaagcaaag gaattctatg gagcaaagta taccaagagt      1560
     gattttaccg gaatgtttcg gaatgtaaaa aagcttttag ataaagggga aacggttctt      1620
     tattctgctc ttccatgtga ggctgcaggt cttcgggcat ttttaagaaa aagatatgat      1680
     aaccttattg ttagtgaagt actatgccat gcgggaccat ctccacttgt atttcgcagg      1740
     tatgttcagt atttagagtc acgttttcat tcaaaggtta aaaaaataaa ttttcgagat      1800
     aaatcaaaag gatggcttgc acttgataat accatggttg tagagtttgc aaatcgagaa      1860
     ccgctaaagc ttcgggcaag aagaaacaat tattatcgta gctttattaa agataatata      1920
     gcaaggcctg cttgcagtca gtgttctttt gtatatacca atcgagtcgg agatttaacg      1980
     atgggtgatt tttggggaat tcagtatgca aaaccagaga tgtttgacaa taagggtact      2040
     agtatattaa tgattaacac taagaatgga gaaaatatct ggaataaaat atcgaatcgt      2100
     ttcgaatatg aagaaagcaa cttgacggaa gcatttcgtt acaatcataa gaaacctata      2160
     aaattaacag aaaagagaaa tgaattcttt gatcgatttg aaaaagaaga aatcaattct      2220
     ttattgcaag aatttaatga tttaaaataa                                       2250
//

If you have problems or comments...

PBIL Back to PBIL home page