(data stored in SCRATCH zone)

EMBL: CP000885.PE563

CP000885.PE563       Location/Qualifiers
FT   CDS_pept        complement(730286..731383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40954"
FT                   /db_xref="GOA:A9KIV5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIV5"
FT                   /protein_id="ABX40954.1"
FT                   /translation="MGYKISARQKIDKIKATKFNSNQNMNDSKDNSIHNNKKLQLNKIL
FT                   HILSFIILMIGTYLLIDLLWISPMKSNNAMKKIQQIYEKSTPIPEDTIAPSIPKAIDDQ
FT                   VSSGKTSEIIPIEKFKQLLELNPDIKGWIQIEGTNINYPVLQSSKEEPEYYLTRNINKE
FT                   EDRLGSLFLDTNTEIETPTQCLLIHGHNMTSTGNMFHELMKFNDMDFLINSPIIQFDTL
FT                   YDVSLWKIFAVFKTNGSSAKEELFDYQRGSFEDSSDFLNFVYQIKVRSIYNIPVEISKE
FT                   DQLLLLSTCSYELPNYRTVIVARKLRPGESKELSRESVTKNKTPLYPDSWYQQYGGIPP
FT                   AITNFEEAQKNHDINWYQDFTNGTR"
     atgggttata aaatttcagc aagacaaaaa atagataaaa taaaagctac aaaatttaat        60
     tcaaatcaga atatgaacga ctcaaaagat aattcaatac ataacaataa aaaattgcag       120
     cttaataaaa tcctccatat actctctttt attatattaa tgataggtac ttatctactg       180
     attgaccttc tatggattag tcctatgaaa tcaaacaatg caatgaaaaa gatccagcag       240
     atatatgaaa aaagcactcc tatccctgaa gatactatag ccccctcaat tccgaaggca       300
     attgatgatc aagtgtcatc aggaaaaaca tccgaaataa tacctataga aaaattcaaa       360
     caactattag aacttaatcc tgacattaaa ggttggattc aaatagaagg aaccaatatc       420
     aactatccag tactacaatc cagtaaggag gaaccagaat attacttgac gaggaatatc       480
     aataaggagg aggaccgatt aggtagtctt tttttagata caaatacaga gattgagaca       540
     ccaacgcaat gtttattaat ccatggtcat aatatgacaa gtactggtaa tatgtttcac       600
     gaattgatga aatttaacga tatggacttt ttgattaatt ctccaattat tcaatttgat       660
     acactatatg acgtaagctt atggaaaatt tttgctgttt ttaaaacaaa cggttcctca       720
     gcaaaagaag aactctttga ttatcaacgt ggaagctttg aagattcctc agatttctta       780
     aattttgttt atcagataaa agttcgttcc atttataata tacctgtaga aatttccaag       840
     gaagatcaac tgctattatt atcaacctgc tcttatgagc ttcctaatta tcgcactgtt       900
     atcgtagcta gaaaattgag gccaggagag tccaaagaac tatcgaggga atccgtaacg       960
     aaaaataaga ctcctcttta tccagatagc tggtatcaac aatacggtgg aattcctcca      1020
     gctattacta attttgaaga agcacaaaag aatcatgata ttaattggta tcaagacttt      1080
     acgaatggca caagataa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page