(data stored in SCRATCH zone)

EMBL: CP000885.PE568

CP000885.PE568       Location/Qualifiers
FT   CDS_pept        complement(736501..737403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0572"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   Cupin 2 conserved barrel domain protein; KEGG:
FT                   cth:Cthe_2212 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40959"
FT                   /db_xref="GOA:A9KIW0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A9KIW0"
FT                   /protein_id="ABX40959.1"
FT                   /translation="MSNSRYNFKIDNESEASMIHKEDSTLSYTFNPDGKQGNQVHVTLL
FT                   YVAISKYGTDWKSLPHSHNFAEFFYITNGSGQFSVEKEILDVKANDLIILNPTIVHTEI
FT                   SNPSKPMEYIVLGIEGIKFQAEDQGYILLNSSAHKSDLHLYFNSLAHEMKSEQPYRNFV
FT                   CQNLLNIIFTMILRNDAFKISIVSGPKLTRECNIAKKYIEENYQENITIETLSSLVHLN
FT                   KYYFVHNFKKQFGTSPINYLIKRRIEESMHLLVSTNHSLSSISQIVGFSSPSYFSQAFK
FT                   RMTNITPQEYKKMYKVPSS"
     atgagtaaca gtcgttataa ttttaaaata gataacgaat ctgaagcgtc tatgattcat        60
     aaagaggatt ctacgctatc ctatactttt aatcccgatg gcaaacaggg caatcaagtt       120
     catgttactc tcctttatgt cgccatttct aaatacggta ctgactggaa aagcttaccc       180
     cattcccata acttcgcaga attcttttat atcaccaatg gatcaggaca gttctctgta       240
     gaaaaagaaa ttcttgacgt aaaggccaat gacttaatca ttttaaaccc tacaatcgta       300
     cacacagaga tctcaaaccc gtcaaagcca atggaatata tcgtgttagg tattgaagga       360
     attaaatttc aagcagaaga ccaaggatat atcctcttaa acagctctgc acataaatcg       420
     gatttgcatc tttactttaa ttcactcgca catgaaatga aaagtgaaca gccataccgt       480
     aactttgtgt gtcagaactt attaaatatc atctttacga tgattcttcg caatgatgct       540
     tttaagattt ctatagtcag cggaccgaaa ctaacaagag aatgcaatat tgccaaaaaa       600
     tatattgaag agaattatca agaaaacatt acaattgaaa ccttaagttc cctcgtgcat       660
     cttaataagt attactttgt tcataacttt aaaaagcagt tcggaacttc tcctattaat       720
     tatttgatta agaggcgaat agaggaaagt atgcatcttc ttgtaagtac gaatcattcc       780
     ttatcctcaa tctcacagat tgtggggttt tcatccccta gctacttttc tcaagcattc       840
     aaacgaatga ctaatataac accccaggaa tataaaaaaa tgtataaagt accatcgtcg       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page