(data stored in SCRATCH zone)

EMBL: CP000885.PE573

CP000885.PE573       Location/Qualifiers
FT   CDS_pept        741481..743652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cpr:CPR_0537 conserved hypothetical protein TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40964"
FT                   /db_xref="GOA:A9KIW5"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KIW5"
FT                   /protein_id="ABX40964.1"
FT                   /translation="MKKDTMLAGRVTIPTDVDVVPETMELLNRWGADAIRDCDGTDYPE
FT                   ELKAVQAKVYSTYYTTRKDNAWAKAHPEEVQQCYIMTSFYTATETTLRIPLLKGIAKEL
FT                   MMVNNYDDKVRWWEVIDRSTAMVVSTDTWSYDKETGEVIITNCEPFHNYTVSFLAYLIW
FT                   DPVHMYNAVVNGWQGVEHQITFDVRQPKTREYSMVRLRKFIEEHPYVDVIRYTTFFHQF
FT                   TLVFDEMMREKYVDWYGYSASVSPYILEQFEKEVGYRFRPEFIIDQGYYNNQYRIPSKE
FT                   FKDFQAFQRREVAKLAKEMVDITHEYGKEAMMFLGDHWIGTEPFMEEFKTIGLDAVVGS
FT                   VGNGSTLRLISDIPGVKYTEGRFLPYFFPDTFHEGGDPVKEAKVNWVTARRAILRKPID
FT                   RIGYGGYLKLACQFPEFIDYVESVCNEFRELYENIKGTTPFCIKRVAVLNSWGKMRAWG
FT                   AHMVHHALYQKQNYSYAGVIESLSGTPFEVSFISFDDIKKDKNILKNIDVIINVGDGDT
FT                   AHTGGLVWEDADISSAIHQFVYEGGGLIGIGEPTGHQYQGRYIQLANVFGIEKETGFTL
FT                   NYDKYNWDAVESHFITEDCTKEVDFGEGKKNMYALEGTTILVQMEKEVQMAVNEFGKGR
FT                   SVYLSGLPYSFENSRVLYRSILWSAHEEENLHKWYSSNFNVEVHAYVKNNKYCVVNNTY
FT                   EPQNTTIYRGDSSSFDLELEANEIIWYEI"
     atgaaaaaag atacgatgtt agctggaaga gttacgatac caacagatgt cgatgttgtt        60
     ccagaaacaa tggaattatt aaatagatgg ggagcagatg ctatccgtga ttgtgacggc       120
     acggattatc cagaggaatt aaaggctgtt caagctaagg tttatagtac gtattataca       180
     acccgtaagg ataatgcctg ggcaaaggcg cacccagagg aagtacaaca atgctatatt       240
     atgacgtcat tttatacagc tacagaaaca acacttcgca ttccactttt aaaaggaatc       300
     gcgaaagagc ttatgatggt aaataattat gatgataaag tacgctggtg ggaagtaatt       360
     gatcgcagta ctgcgatggt cgtttcaaca gatacctgga gttatgacaa agaaacagga       420
     gaagtaataa ttacaaattg cgagccattc cacaactata cagttagttt tcttgcttat       480
     cttatctggg atccggtgca catgtacaac gcggttgtca atggatggca aggcgtagaa       540
     catcagatta catttgatgt aagacagcca aagactagag agtattctat ggttcgtctt       600
     cgtaagttta tagaagaaca tccttatgtt gatgtgattc gttatacaac cttcttccat       660
     cagtttactt tagtatttga tgaaatgatg cgtgaaaagt atgttgactg gtatgggtac       720
     tcagcttctg tatctcctta tatcttggag cagtttgaaa aggaagtggg ttatcgattc       780
     agaccagagt ttattattga tcaagggtac tataacaatc agtatcgtat cccaagcaag       840
     gaatttaaag attttcaagc gttccagaga cgtgaagttg caaaattagc caaggaaatg       900
     gtagacatca cccatgaata cggtaaggaa gcgatgatgt ttcttgggga tcactggatt       960
     ggaacagaac cctttatgga ggagtttaag acaatcggtc ttgatgcagt agttggaagt      1020
     gtagggaatg gtagtacact tcgattaatt agtgatatcc caggggttaa gtataccgaa      1080
     ggaagatttc ttccttattt cttccctgat actttccacg aaggtgggga tcctgttaaa      1140
     gaagcgaagg ttaactgggt tacagcaaga cgtgccatct taagaaagcc aattgataga      1200
     atcggatatg gcggttactt aaaacttgca tgccagttcc cagagtttat tgactatgtg      1260
     gaatctgttt gtaacgaatt tcgtgagctg tatgaaaaca ttaagggtac aacgccattt      1320
     tgtatcaaac gtgtagctgt tttaaatagt tggggtaaaa tgcgagcttg gggtgcccat      1380
     atggtacatc atgcacttta tcaaaagcaa aactatagtt atgcaggtgt cattgagtca      1440
     ttaagcggaa caccttttga agtgtccttt atcagctttg atgacattaa aaaggataaa      1500
     aatatcttaa aaaatattga tgtaattatt aatgtgggag atggtgatac agcacacact      1560
     ggtggattag tttgggaaga tgctgatatc tccagtgcta ttcatcagtt tgtatatgaa      1620
     ggtggcggct taattggtat tggagaacct acgggacacc agtatcaggg acgttacatt      1680
     cagttagcta atgtttttgg catcgaaaaa gaaactggtt ttactttaaa ttatgataaa      1740
     tataattggg atgctgtgga aagccatttt atcaccgaag attgtacaaa agaagtagac      1800
     ttcggtgagg ggaagaaaaa tatgtacgcc ttagagggta ctaccattct tgttcagatg      1860
     gaaaaagaag tacagatggc tgtgaatgaa tttggcaagg gaagaagtgt atatctaagt      1920
     ggtcttccat atagttttga gaatagcaga gttctttacc gaagtattct ttggagtgct      1980
     catgaagaag aaaacttgca taaatggtac tccagtaact tcaatgttga agtgcatgct      2040
     tatgtaaaaa acaacaaata ttgtgttgta aataacactt atgagccaca aaatacgacg      2100
     atttaccgag gtgattccag tagttttgat ttagagttag aagcgaatga aattatttgg      2160
     tatgagatat aa                                                          2172
//

If you have problems or comments...

PBIL Back to PBIL home page