(data stored in SCRATCH zone)

EMBL: CP000885.PE62

CP000885.PE62        Location/Qualifiers
FT   CDS_pept        89122..89832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0063"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: bvu:BVU_1472 histidinol phosphatase
FT                   and related hydrolase of the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40453"
FT                   /db_xref="GOA:A9KQE4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQE4"
FT                   /protein_id="ABX40453.1"
FT                   /translation="MDKLVADIHTHTIASGHAYGTIREMAQAAAEKHLRILGISEHAPG
FT                   IPGTVDPFYFRNLEIVPRDLYGVHIIHGCEINVLNDGTLSLQQEYIDMLDYAIVGIHCQ
FT                   CYEDQGREKNTENLIKCMQNEKVHFISHPDDDHTPLNYKELVQAAKETHVALEVNNSSL
FT                   IKKDRRLNCIENYKTMLHYCKQYHVPIIISSDAHDPSYVGRFNLAVDLIESQNFNKDLV
FT                   LNVDSKKLISFIYD"
     atggataaat tagttgcgga tattcataca catacaatag caagcggaca tgcatatgga        60
     acaatccgtg aaatggcaca ggctgctgct gaaaagcatc ttcggatttt aggaatcagt       120
     gagcatgctc ccggaattcc gggaaccgtt gatccgtttt actttcgcaa tcttgaaata       180
     gtaccgagag atttatacgg tgttcatatt attcatggct gtgaaatcaa tgtgctgaat       240
     gatggtactc tgtctttgca acaggaatac attgacatgc tggattacgc tattgttgga       300
     atccattgcc agtgctatga agatcaaggc cgggaaaaaa atacggaaaa cctgattaaa       360
     tgcatgcaga atgagaaagt gcattttatc tcccatccag atgatgatca tacgccattg       420
     aactataaag aacttgtaca ggccgcaaaa gaaacgcatg tggcactgga ggttaacaat       480
     agttcattga ttaagaaaga tagacggtta aattgtattg aaaactataa aaccatgctt       540
     cattactgta agcagtatca cgtaccaata ataattagtt cagatgctca tgatccaagt       600
     tatgtaggaa gattcaatct cgccgtagac cttattgaat cgcaaaattt caataaggat       660
     ttggtgttaa atgttgattc aaaaaaatta ataagcttta tctatgacta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page