(data stored in SCRATCH zone)

EMBL: CP000885.PE68

CP000885.PE68        Location/Qualifiers
FT   CDS_pept        98284..98904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40459"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF0"
FT                   /protein_id="ABX40459.1"
FT                   /translation="MVVSYDPALAVAYAVQFGDQEQNGIFKRMSEDCTNFISQCIWAGY
FT                   GGTEGYSLTSEADILALRERVAKNYRQTSIWYGRNYASPSPIASGAFIRVEELWNYVTT
FT                   NRGPGPKAIGYNNRQYWGYAPVDLALGDVLQFYHSNLGRYGHTVMVTATTENPQPIESA
FT                   LGNVYVAQHTADYSYRPFSDVLDTNGGIEGAWMRVLKFTDTYF"
     atggttgttt cttatgatcc agcattggca gttgcatacg ccgtacaatt tggagatcaa        60
     gaacaaaatg gaatatttaa acggatgtca gaagactgta cgaattttat ttcgcagtgc       120
     atttgggccg gatatggagg tacagaaggg tattctttaa caagtgaggc agatattttg       180
     gcacttagag aaagagtagc taagaattat cgtcaaacaa gcatctggta tgggagaaac       240
     tatgcctctc cttccccaat tgcatctggg gcatttatta gagtagagga gctgtggaat       300
     tacgttacaa caaatcgggg gcctggacct aaagctattg gctataacaa tcggcaatac       360
     tggggttatg cgcctgtgga tttagcactt ggagatgtct tacagtttta tcatagtaat       420
     cttggacggt acggtcatac cgtaatggtg acggctacga ctgagaatcc gcagccaatt       480
     gaaagtgctt tgggaaatgt ctatgtagca caacatactg cagattatag ttatcgtcca       540
     tttagcgatg tactggatac caatggtggc atcgaaggag cgtggatgcg ggtgctaaag       600
     tttacggata cttattttta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page