(data stored in SCRATCH zone)

EMBL: CP000885.PE71

CP000885.PE71        Location/Qualifiers
FT   CDS_pept        102256..103299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40462"
FT                   /db_xref="GOA:A9KQF3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQF3"
FT                   /protein_id="ABX40462.1"
FT                   /translation="MRITRGKKEKSAEIIGWRKKLLFGCVFLLATLVLAVVFAPFILVY
FT                   YITRGPVLYQVEASFDHPLQEVYKASDFLLEDKMLPIRTQDGFSLWASEIEVENPKAIV
FT                   IYLTDLKQPSITYFYGHAKWMKDNGYASILLETRGHGESDGDVIGLGYTEVNDVKAVVE
FT                   YIQKQECYRDVPIVLQGFSMGGAVAINAFGQIPEIDALIAMSAYTSTEDAMIDSMRDHG
FT                   VPEFLCKIERPLIKFALSIVFGRDAVETLKPIEQIKNANDRPVFFISSKEDLKVSLENI
FT                   RRFREVNPEAEYWVRDSAAHLDIDDNDFTNVEKDTEYCNRILDFLDKVKKAKQNVLSMT
FT                   KKAYFLL"
     atgaggataa caagggggaa aaaagaaaag agtgcggaga taattggatg gaggaagaaa        60
     cttctattcg gttgtgtttt tttgcttgct acccttgtat tggcagtcgt atttgcacct       120
     tttatattgg tatattacat tacaagagga ccagtccttt accaagtgga agcttctttt       180
     gatcatccgt tacaagaggt ttataaggct tcggattttt tattggaaga taagatgctt       240
     cctattagaa ctcaagatgg tttctcctta tgggcatctg aaatagaggt tgagaatcca       300
     aaagctattg ttatctatct gacggatctc aagcaacctt ctatcacata tttttatggt       360
     catgcaaaat ggatgaagga taatgggtat gcctcgatac tattagaaac tagaggtcac       420
     ggagaaagtg atggtgacgt aataggcctt ggttatactg aagttaatga tgtaaaggct       480
     gttgtcgaat atatacagaa acaggaatgc tatcgagatg ttccaattgt tcttcaagga       540
     ttttctatgg gtggagcagt tgcaattaat gcctttgggc aaatacctga aattgatgca       600
     ttgattgcga tgtctgctta tacgagtact gaagatgcta tgattgattc gatgagggat       660
     catggagttc cagagttcct atgtaaaatt gagcgcccat taattaagtt tgctttgtcc       720
     atagtgtttg gaagagacgc tgtagagaca ttaaagccaa ttgaacagat taagaacgcg       780
     aatgatcgcc ccgtattttt tatttccagc aaagaggatt tgaaagtttc attagagaat       840
     atcagacgat ttcgagaagt caatcctgag gcggaatact gggtaagaga ctctgcggca       900
     catttagata ttgatgataa cgattttact aatgtagaaa aagatacgga atattgtaat       960
     cgaatcttag attttttaga caaagttaaa aaagcaaagc aaaacgtcct gagcatgacg      1020
     aaaaaggctt attttttatt gtaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page