(data stored in SCRATCH zone)

EMBL: CP000885.PE78

CP000885.PE78        Location/Qualifiers
FT   CDS_pept        108728..109885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0079"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: bld:BLi04006 YxjM"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40469"
FT                   /db_xref="GOA:A9KQG0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG0"
FT                   /protein_id="ABX40469.1"
FT                   /translation="MNENIIRYQFVLIKGLLLGAVFLYHVMEQQNKLLSQYGVWVIYAL
FT                   LFAALIAQGITKRHKALLLLIQTGLVIVMISWFGREYALVLPVIFLSIAGSLKIRYPYY
FT                   ATAILGAFVYSGNIAVYLLFTFVCILLFIQNDVIIDKYKNLLQSYEQNEQRLKHSMDNQ
FT                   SHIYKKELIENSLFFENKLLEEKGRLSQALHDKLGHSINGSIYQLEATKVLLTSEPEQA
FT                   NGILQAVIDNLRISMDEIRQLLRGEKPDKRKMALLQLMTLCDECKKKYNIEAEVIMSGD
FT                   NKSVPEYIWEVILDNSFEAVSNALKYSKCKHITIQIVILNKLVRCTIEDDGVGCMQINE
FT                   GMGIAGMRKRVRAINGVLDVTAQIGFCINMILPISTLYNNARSEK"
     ttgaacgaga atatcattcg gtatcaattt gtattaataa agggtctctt actaggagca        60
     gtttttttat atcatgttat ggaacaacaa aataagcttt tgagtcaata tggagtttgg       120
     gtgatatatg ctcttttatt cgctgcatta atagcgcagg ggattactaa gaggcataag       180
     gctcttttgc tattgataca aactggtctt gtaattgtta tgatatcttg gtttggaagg       240
     gaatacgctc tggtccttcc agtaatattt ttaagtatag ctggtagtct aaagattcga       300
     tatccgtact atgcgaccgc tatcttagga gcatttgtat attccggtaa tatagctgtg       360
     tatttattgt ttactttcgt ttgtatatta ctttttatcc aaaatgatgt cattatagat       420
     aaatataaaa atttactaca atcctatgag caaaacgaac aaaggcttaa gcattccatg       480
     gataatcaaa gtcatattta taaaaaagaa ttgatagaga atagcttatt ttttgaaaat       540
     aaactgttag aggaaaaagg acgcttatca caggcattac atgataagtt aggacacagc       600
     atcaatgggt caatatatca attagaggca actaaggttt tactaacaag tgagccagag       660
     caagcaaatg ggattttaca agcggttatt gataacctaa gaataagtat ggatgaaata       720
     cggcaattac ttcgcgggga gaaaccagac aaacgaaaaa tggcattact tcagcttatg       780
     accttgtgtg atgagtgtaa gaaaaaatac aatatcgagg ctgaggttat tatgagtgga       840
     gataataagt cggtgccaga gtacatatgg gaagtcatct tagacaattc cttcgaggcg       900
     gtatccaatg ccttgaaata ttcaaagtgt aagcatatca caattcaaat cgtaattttg       960
     aataaacttg tgcgatgtac tatagaagat gatggagttg ggtgtatgca gataaatgag      1020
     ggcatgggaa ttgcgggaat gcgcaaacgg gttcgagcaa tcaatggagt tcttgatgtc      1080
     accgctcaaa tcgggttctg cattaatatg attttaccaa tctccacatt atataacaac      1140
     gcaagaagcg agaaatga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page