(data stored in SCRATCH zone)

EMBL: CP000885.PE84

CP000885.PE84        Location/Qualifiers
FT   CDS_pept        114069..115049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40475"
FT                   /db_xref="GOA:A9KQG6"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQG6"
FT                   /protein_id="ABX40475.1"
FT                   /translation="MRKNKILILFLVIFTLTTTNIVTLLYLNHIIHSNSEQLVFAYDAI
FT                   MVRDNEISRLEGLENENNRLTLENQTLNTTNENLTSQKEQLSREQSSLKQQVSEQSEEI
FT                   VVLTNQNLNMNRVLEKYSYFLDYEPEILNEYQTYIKELEQKVESSGSFDIYEVPKRKKV
FT                   YEGYTIWLEDGASERWADQAMDYLKLVPAKALEVLNKDKWYLIITPRSLEEVYHSGVEN
FT                   TIGLTIYYRKRIYIKNNEFSIDSCTLHEIGHALDALNSYQSFTEGFNDIFNEESAASGL
FT                   SKYFTSSPTEYFAETFQNYFISPELTKRNAPKSYAFIEKFLEKYE"
     atgagaaaaa ataaaattct gattttattt cttgtaattt ttacactcac tacaaccaat        60
     attgtcacgt tgttatactt aaatcacatc attcacagca atagtgaaca gttagtattc       120
     gcatatgatg ctattatggt acgagacaat gagattagca ggttggaagg attagagaat       180
     gaaaataacc gattaacctt agaaaaccaa acactgaata cgacaaatga gaacctaacc       240
     agtcaaaaag aacaattatc tcgtgagcag tcttcactaa aacaacaggt ctctgaacaa       300
     tcagaggaaa tcgtggtatt aacaaatcag aatcttaata tgaatagggt tctggagaaa       360
     tatagctatt ttctagatta tgagcctgaa atattaaatg aatatcaaac ctatattaaa       420
     gaactagagc agaaagtaga aagttcaggc agttttgata tttacgaagt tccaaagaga       480
     aaaaaggtat atgaaggtta tactatttgg ttagaagatg gggccagtga aagatgggca       540
     gatcaagcca tggattattt aaaactagta cctgcgaaag cattggaagt actaaataaa       600
     gataaatggt atctaatcat cactccaaga agcttagaag aagtgtatca tagcggtgtt       660
     gaaaacacga tagggctaac gatatattat agaaagcgta tttacataaa aaataatgaa       720
     ttttcaattg attcgtgtac gttacatgag atagggcatg cattggatgc cttaaatagc       780
     taccaatcgt ttacggaagg atttaatgat atttttaatg aggaaagtgc agcgtctggc       840
     ttatcgaaat actttacaag ctctccaacg gagtattttg cagagacttt tcaaaattat       900
     ttcattagcc cagaattaac aaaaagaaat gcaccaaaat catatgcatt tattgaaaaa       960
     tttcttgaga aatatgagta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page