(data stored in SCRATCH zone)

EMBL: CP000885.PE88

CP000885.PE88        Location/Qualifiers
FT   CDS_pept        complement(119038..119523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0089"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: cbe:Cbei_4112 NADH dehydrogenase
FT                   (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40479"
FT                   /db_xref="GOA:A9KQH0"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH0"
FT                   /protein_id="ABX40479.1"
FT                   /translation="MLGQDEKGLIDNILTAHDYNKSHVIAIMQEVQKVYRYLPEEVLCY
FT                   IAEKLKLSEAKIYGVATFYENFSLEPKGKYVIKICDGTACHVRKSIPILEEFRKVLGVT
FT                   EKNPTTDDMIFTVETVSCLGACGLAPVCTVNDVVHAAMTPEKAKALIEQLREEAFQC"
     atgttagggc aagacgaaaa agggctcatt gataacatcc tcacagccca tgactataat        60
     aagtcacatg taatagcgat tatgcaagaa gtacagaaag tatatcgcta tttaccggag       120
     gaagtacttt gttacatagc agaaaaacta aagttaagtg aagctaagat ctatggagtt       180
     gcaacctttt atgaaaactt ctccttagag ccaaaaggaa aatacgttat aaaaatttgt       240
     gacggaactg cttgccatgt tagaaagtcc atccctattt tggaggaatt ccgtaaagtt       300
     cttggtgtta cagagaaaaa tccaaccaca gatgacatga tatttaccgt ggaaacagta       360
     tcctgccttg gcgcatgcgg cttagcacca gtatgtacgg taaatgatgt cgttcatgct       420
     gcaatgacac cagaaaaagc aaaagcactc attgaacagt taagagagga ggctttccaa       480
     tgttaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page