(data stored in SCRATCH zone)

EMBL: CP000885.PE91

CP000885.PE91        Location/Qualifiers
FT   CDS_pept        complement(122755..124488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0092"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; hydrogenase large subunit domain protein; Fe-S
FT                   cluster domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; KEGG: tte:TTE0697 ferredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40482"
FT                   /db_xref="GOA:A9KQH3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQH3"
FT                   /protein_id="ABX40482.1"
FT                   /translation="MNVIGFKEAKCKNCYKCVRNCDVKAITVKDAQAYIMNDKCILCGH
FT                   CLEVCPQNAKTLISDLERVKGYLREGYQTVVSLAPAYLGVLHYNTPGQVISALLKLGFT
FT                   AVRETAEGAAYVTREYDNLIAAGEMENIITTCCPSLNDLVEIYYPSLTKYLAPVVSPMI
FT                   AHGKIIREQYGPNVKVVFLGPCISKKREAESDPRTVGIIDAVINFKELEEWLLEEGIDI
FT                   FKQPDTPPDNPNPLVNRLYPISSGVLSSVVASKNTSDHYRKFYVHGINNCIDLLESMNR
FT                   GEITGCFIEANICNGGCIKGPAIDRTRISRFKVKLDMEESIPKAPITEEDFFTKSPIHF
FT                   DKFFLGRSPKDPVPTEKEVMQILAKIGKTKPEDMLNCGACGYATCRDKANAVYQGKAEL
FT                   NMCIPYMHERAQSMANFVLDTTPNIIIIVDAEMKIMEFSAAAEKYFRTPRSVAKEMYLY
FT                   EFIDHSNFQAVLETQKDIIGKRVIYEDRNLATLQTIVYSKEQNCVLGIFQDISHQEELD
FT                   RKAYKVKVETIEMAQRVIDKQMKVAQEIAGLLGETTAETKVTLTKLRDTILNDGKPYDI
FT                   F"
     atgaatgtga ttggatttaa agaagcaaag tgcaaaaact gttataagtg tgtgcgtaac        60
     tgcgatgtga aagcgatcac tgttaaggat gcacaagctt atattatgaa tgataaatgc       120
     atattatgtg gacactgtct tgaagtttgt ccacagaatg caaaaaccct aatcagtgat       180
     ctagaacgcg taaaaggata tctaagagag gggtaccaaa ctgtagtttc tcttgcacct       240
     gcctatctgg gtgtgctaca ttataacact cccggacagg taattagtgc tttattaaag       300
     ttaggtttca cagcagtcag agaaactgca gaaggtgcgg cttatgttac gagggaatat       360
     gataatttaa ttgcagcagg agagatggaa aatatcatca ctacctgctg ccctagtctg       420
     aatgatctcg tagaaattta ctacccctcc ctaacgaaat atttagcacc ggttgtatct       480
     cctatgatag ctcacggtaa aattatacga gaacaatatg gtcctaatgt aaaagttgtt       540
     ttccttggtc cttgtatctc aaaaaaaaga gaagcagaaa gtgacccaag aacagttggt       600
     attattgatg ccgttattaa ctttaaagaa ttggaagaat ggttactaga ggaaggtatt       660
     gatatcttta aacagccaga tacccctcca gataatccaa atccacttgt aaatcgcctc       720
     tatccaatca gtagcggtgt tctctcctct gtcgtagcat ccaaaaatac gtccgatcat       780
     tatcgaaaat tttacgtgca tggtataaat aactgcatcg acttactaga aagcatgaac       840
     cgtggtgaaa taactggttg tttcatcgaa gcaaatatct gcaatggtgg ttgtatcaaa       900
     ggccctgcaa tagatcgaac ccgaatctca cggtttaaag tgaaacttga catggaagaa       960
     tccattccta aggcgccaat taccgaggaa gattttttta cgaaatctcc aattcatttt      1020
     gataagttct ttcttggccg atccccaaag gacccggtcc caacggaaaa agaggtgatg      1080
     cagatactag cgaaaatcgg taaaacaaaa cctgaggata tgttaaactg cggtgcttgt      1140
     ggttatgcta cctgccgtga taaagcaaat gctgtttacc aagggaaagc agagcttaat      1200
     atgtgcatcc cctatatgca cgaacgtgca caatccatgg ccaacttcgt tcttgatacg      1260
     actccaaata ttattattat cgtagatgca gagatgaaaa ttatggagtt ttctgcggcg      1320
     gctgaaaaat attttagaac tccccgctct gtagctaagg aaatgtatct ctatgaattt      1380
     attgaccata gtaattttca ggcagtacta gagacacaaa aagacatcat cggaaagaga      1440
     gtcatctacg aagaccgaaa tcttgcaact ttgcagacca ttgtatattc taaagaacaa      1500
     aactgtgtac tgggtatctt tcaggatatc tcacaccaag aagaactcga ccgtaaggct      1560
     tacaaagtga aggtggaaac cattgagatg gcacaacgtg ttattgataa acagatgaag      1620
     gttgcacagg aaattgcagg tttacttggt gaaaccacag cagaaacaaa agttacccta      1680
     accaaactac gggatacgat actaaacgat gggaaacctt atgatatttt ttag            1734
//

If you have problems or comments...

PBIL Back to PBIL home page