(data stored in ACNUC9435 zone)

EMBL: CP000904.PE1

CP000904.PE1         Location/Qualifiers
FT   CDS_pept        5..1597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5433"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ3"
FT                   /protein_id="ABY46425.1"
FT                   /translation="MTLLLNKHTTSMMSMLPQWMKMAKDPKSVGALFLDAFGVELSEIE
FT                   RYIEQAWNDMYIGTTNLQKADYCYKIPLATRDVVDIETLDLHVRLVIDGVRRDCMPADT
FT                   LRLFFESDDNSYMIDTIEGYVYIKVMDYYMKDNIFKPFDAIEVGDTLHYEYMLHHIWNV
FT                   FDEFGMLLGISRLPGERNGDFKNRILDVFKNPGGATKQGLINGISRELGIDKSEVKLGS
FT                   LSDDKYVQTKLMNTDGTPSETYIQYVNQINSNLGFSWDHMNWGEAYWRSIEENNMGFHY
FT                   LPHIWDGFSASWKDNEVQSGIGSGDDLLVTAPKEESPVREFKTYVGLHGTEEQIEENHP
FT                   EIQFKYKIVAKGKIPNDEYELEDYKYTVMSSEIIPLHYVLVALREFLYQTHITWDNRYG
FT                   YTFSDNTSPGMEVVTGEDVLHNNEEPQIKIHVDMKTADRTVTPVLEELIVDWIDQNDAP
FT                   QSYKLTTDEDFTLNNTRTQTTLADVEVGNGSVTLGRGSFSAVIDTEGSFLRGSQGISVR
FT                   VNREGSLSLNLPN"
     gtgacactat tgttaaacaa acatacaaca agtatgatgt ccatgcttcc gcaatggatg        60
     aagatggcca aagatccaaa atcagtaggg gccttgtttt tagatgcatt tggtgttgaa       120
     ttatcagaga ttgaacgata catagagcaa gcttggaacg acatgtacat tggtacaaca       180
     aacttacaaa aggccgatta ctgttataag attccgcttg ctactcgtga tgttgtagat       240
     attgagacac tagatctcca cgttcgttta gttatcgacg gtgtacgaag agactgtatg       300
     ccggctgata ctttacgact attttttgag agtgatgaca actcctacat gattgatact       360
     atcgaaggtt atgtatatat caaagtaatg gattactata tgaaagataa tatcttcaaa       420
     ccattcgatg caattgaagt aggggacacc cttcactatg aatatatgct tcatcatatc       480
     tggaatgtat ttgatgagtt cggtatgtta ctaggtattt ctagattacc aggtgaaaga       540
     aacggagact ttaagaatcg tatcttagat gtttttaaga atcctggcgg agcaacaaag       600
     caaggattaa tcaatggtat tagtagagaa ctaggtattg ataaatcgga agttaaatta       660
     ggctcactat ctgatgataa gtatgttcaa acaaaactta tgaatacaga tggtacacct       720
     tccgaaacat atatccaata cgtaaatcag attaatagca atctaggttt ttcttgggat       780
     catatgaact ggggagaagc ttattggaga agtattgaag agaataatat ggggttccat       840
     tatctacctc atatttggga tggtttctct gcttcatgga aagacaacga agtacaatca       900
     ggtattggta gcggagatga cttattagta accgcaccga aagaagagtc tcccgttcgt       960
     gagtttaaga cttatgttgg cttacatggt acagaagaac aaatagaaga gaatcaccca      1020
     gaaatacaat tcaaatacaa gatagtggcg aaagggaaaa tacctaatga tgaatacgaa      1080
     ttggaagatt acaagtatac agtaatgtct tcagaaatta ttccactaca ttacgtatta      1140
     gtcgctttac gtgagttctt atatcaaact cacatcactt gggataatcg ctatggatac      1200
     acttttagtg ataatacatc tcctggtatg gaagttgtta caggtgaaga tgttcttcac      1260
     aataacgaag aaccccaaat taaaattcat gtagacatga aaactgcgga tagaacagtg      1320
     acacctgttt tagaagagct tatagtggac tggatcgatc agaatgatgc acctcagtct      1380
     tacaaattaa caactgatga agattttacc ttaaacaata caaggactca aacaacgtta      1440
     gccgatgtag aagtaggtaa cggttctgta actcttggta gaggttcatt ctctgctgtt      1500
     attgatacag agggttcatt cttaagagga tcacaaggta tatccgtaag agttaacaga      1560
     gaaggttctt tatctcttaa cctaccaaac taa                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page