(data stored in ACNUC9435 zone)

EMBL: CP000904.PE10

CP000904.PE10        Location/Qualifiers
FT   CDS_pept        27615..30392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6767 outer membrane
FT                   autotransporter barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5442"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46434"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV02"
FT                   /protein_id="ABY46434.1"
FT                   /translation="MELFSALASGSGPTMLYTVYADETSRSANSVTYSVTCWARLQNQT
FT                   YDYFGAVVYPKINIGGNTVSFANLGTFPKGAGAKFSTISVTVSGISATTSSVSYTFSAT
FT                   SQLGGTSSSTTGYVGGKSGTVSCSIYATTPWLSGQIWIKDGSTTVDSYYRENLGTGSFV
FT                   LNWSGANGANGTLTYEIQRQINGGAWTIVAADNNGTFSDAPGAGANSVRYSIQAKNKVG
FT                   TDVMRSDWIYSPTVYKNELRSPSLTSSAYVSYATRTFTLSLGAASDNLGSPISYTLTGI
FT                   ASKFTTINGPGGVSPGNITINANNGSSGIYMTIDNLKTAALNGTAHSDTNYYIGSIDLQ
FT                   VTATNGKGSSKTDTVSIPINLGMDAPVSGTPSVTIAATSYYLINTANYIFPEYKPVSLT
FT                   IAGAIKDMLGRNCSYDIVMVEGNSQSIIKNTGIVTAATTATVNHVESGLLTAKKNVSFY
FT                   VRAQTLGNEGKPSAQTPKVDLHYYKKPSVTSSDLSRITGKSTFKVVVTPSNSLGGATNT
FT                   STMPSGYTKGTSSIASGVETYTVTSSTTLADSYTALISVVVRDSVGYILSSNGSNDVTL
FT                   KVTIPTFTPALSIRERGIGINGFAGTTEKLYVGGNVKLTGNLIVGGIIDMGNTNIENVN
FT                   HITITDPGGGEGLEWKDPTNNWKIVVAPDNLGNATGDLQFARNGVRRATVRANGEVAAV
FT                   GGFATINPSNTNASVSLNFLNNIARIRTGGTGAGADNGFQIHGTGDVIRWSVDGAGTVS
FT                   NYGHLQMFNGKEIQFMNRSGMAFDGNGNMKPRDLLTHAAGAYWWVNDVNNNYPLKVWTG
FT                   ANGGYADVRSRPFTQVTAFTNGWADYGSFGPVAYTKDAAGFVVLQGLLRGNSGTSGSAF
FT                   QLPTGFRPSTSRIFNVVNGVNGHSRLDVNADGTVVMQGGAPEFCSLNGIRFLPA"
     atggaattat ttagtgcttt agcgtcgggc tcaggcccga ccatgcttta tacagtttac        60
     gcagacgaaa caagtcgttc tgctaactca gtaacatata gtgttacatg ttgggctagg       120
     ttgcaaaacc aaacctatga ttactttggc gcagtagttt atcccaaaat aaacataggt       180
     ggcaatacgg tatctttcgc taatttaggt acattcccaa aaggagctgg cgctaaattt       240
     agtactatta gcgtaactgt atcaggtata tcagcaacaa catctagcgt atcatatacg       300
     ttctcggcaa catcacaact tggaggaaca tcaagtagta ccacaggtta cgttggaggt       360
     aaatcaggta cagtatcttg ttctatttac gctacgactc cttggctaag tggtcaaatt       420
     tggattaaag atggctcaac aactgttgat tcttattata gagaaaattt aggaacagga       480
     tcattcgtcc taaactggtc aggtgcaaat ggagccaacg gaacacttac ttatgaaata       540
     cagagacaaa taaatggagg ggcttggaca atagtagctg ccgataataa cggaaccttt       600
     tcagatgctc caggggcagg tgctaactcc gttcgttatt ccatacaggc aaaaaataaa       660
     gtaggaacag atgttatgcg ctccgattgg atttattctc cgacagtata taaaaacgaa       720
     ttaagatctc catcactaac atctagtgcc tatgtttctt atgctacaag aacatttaca       780
     ctatcactcg gagccgcatc ggacaatctt ggatcaccga taagttatac actaacagga       840
     atagcaagta agtttacaac aattaatgga ccaggtggtg tgtccccagg gaacattact       900
     attaatgcaa acaatggatc atctggtatc tatatgacta tagacaatct gaagacagca       960
     gcattaaatg gtacagcaca ttcagatacg aattattata taggttcaat cgatttacaa      1020
     gtaactgcta caaatggtaa agggtcatca aaaaccgata cagtttcaat tccaattaat      1080
     ttaggaatgg atgctccagt aagtggaacg cctagcgtta ctatagcggc tacttcttat      1140
     tacttaatca atacagctaa ttatattttc cctgaatata aacctgtttc acttacaatt      1200
     gcaggagcga tcaaggatat gcttgggcga aattgcagct atgacatagt tatggtagag      1260
     ggaaatagtc aatctattat taaaaataca ggtattgtaa ctgctgcgac tacagcaaca      1320
     gttaaccatg tagaatctgg attactaact gctaagaaaa atgtttcctt ctatgtaaga      1380
     gcacaaacgt taggtaatga aggaaaaccc tctgcacaaa ctccaaaagt agatcttcat      1440
     tattataaaa agccaagtgt tacttcaagt gatttatctc gtattacagg taaatcaaca      1500
     ttcaaagtag ttgttactcc ttctaactca ttaggtgggg ctactaatac ttcgacaatg      1560
     ccttcaggat acacgaaagg gacatcgagt atagcttccg gagtagaaac ctatacggta      1620
     actagtagta caactcttgc ggattcatat actgcattaa tttctgttgt cgttcgtgac      1680
     tcagtaggtt acattttgag ttcaaatggt tcgaatgacg ttaccctgaa agtaactatc      1740
     cctacattca ctcctgcatt atctatccgc gaaagaggaa taggtattaa tggttttgca      1800
     ggaactaccg aaaaacttta tgttggtggt aatgtcaaac ttactggtaa cttaattgtc      1860
     ggtggaataa tcgatatggg taatacgaat atcgaaaatg taaatcacat tacaatcact      1920
     gatccaggtg gcggagaagg gcttgaatgg aaagacccta caaataactg gaagatcgta      1980
     gttgcaccag acaaccttgg aaatgctaca ggtgacttac aatttgctcg aaatggtgta      2040
     agaagagcca ctgtaagagc aaatggtgaa gttgcagcag taggtggttt tgccacaatc      2100
     aaccctagta atacgaatgc atcagtttca ttaaacttcc ttaacaatat cgcaagaatt      2160
     cgtactggcg gaacaggtgc cggtgcagat aatggatttc aaatacatgg aactggtgat      2220
     gttattagat ggtcagtaga cggtgctgga accgtatcaa actatggtca cttacagatg      2280
     ttcaatggta aagaaattca attcatgaac agatctggca tggcatttga cggaaatgga      2340
     aacatgaaac ctagagatct tttaactcac gcagcaggtg cttactggtg ggtaaacgat      2400
     gtaaataata actacccact taaggtatgg acaggagcta atggtggtta tgctgatgtt      2460
     agaagtagac cattcacaca agtcacagca tttactaatg gatgggcgga ttacggttcc      2520
     tttggtccag ttgcctatac aaaagatgca gcaggatttg ttgtgctaca gggtttatta      2580
     agaggtaata gtggtacgag tgggtctgca ttccaactac ctactggatt tagaccaagc      2640
     acatcacgta tatttaatgt cgttaatggt gttaacggtc attctcgtct agatgtaaat      2700
     gcagatggaa ccgttgtaat gcaaggcggt gcccctgaat tctgttctct aaatggaatt      2760
     agattcctac ccgcataa                                                    2778
//

If you have problems or comments...

PBIL Back to PBIL home page