(data stored in ACNUC9435 zone)

EMBL: CP000904.PE100

CP000904.PE100       Location/Qualifiers
FT   CDS_pept        complement(145655..146524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_1765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5542"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46524"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV92"
FT                   /protein_id="ABY46524.1"
FT                   /translation="MNQLSLTNKERTSNGKDVGSLRIAFTIENTTNSTFSFSFNKMRAT
FT                   TDQGELFEPSTFIKQNFINPTKKIDDTQDNKIVFNDYGTKDLESIQWVDFTFEINKKSP
FT                   EITIAKTQKYKIRFNIDQHYGGTTTKQEQPQTSSNTDDVTYKNEIKPKIDSMIKEFNNI
FT                   WNQEVKSVFNKEGETLATINQNTLQEQMELVSTKYRELSKENINFNSSDKINDPTLKEK
FT                   INKFREEFGAAANYRENAANAILQGIRDLAPMEDRMKEARKSIKISEQKFNNASTHLTE
FT                   FETKLNSK"
     atgaaccaac tatctttaac taataaagaa aggacttcaa atggaaaaga cgtgggttct        60
     ctccgaattg catttacaat tgaaaataca acaaattcta ctttctcttt tagctttaat       120
     aagatgcgtg ctactactga tcagggcgaa ctatttgaac catccacatt tattaaacaa       180
     aattttataa atcctactaa aaaaatagat gatacacagg ataataaaat tgtatttaat       240
     gattacggaa caaaagattt agagtctata caatgggttg attttacttt tgaaataaat       300
     aaaaaaagtc ctgaaataac aattgcgaag acacaaaaat ataaaattcg attcaatata       360
     gatcaacatt atggaggaac tacaactaaa caagaacagc ctcaaacttc ttcaaatacg       420
     gatgatgtta catacaaaaa tgaaattaaa cctaaaattg attccatgat aaaagagttt       480
     aataatatat ggaatcaaga agtaaaatca gttttcaaca aagaggggga aactttggca       540
     actataaacc aaaatacttt acaagaacag atggagcttg tatctactaa atacagggaa       600
     ttgtcaaaag aaaatattaa ctttaattcc tctgataaaa taaatgaccc aactttaaaa       660
     gaaaaaataa ataaatttag agaagagttt ggtgctgcgg caaattatag agaaaatgca       720
     gcaaatgcta tattgcaagg aatacgagat ttagctccaa tggaagacag aatgaaagaa       780
     gcaagaaaat ccattaaaat ttctgaacaa aagtttaata acgcttcaac tcatttaact       840
     gaatttgaaa caaaactaaa tagtaaatag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page