(data stored in ACNUC9435 zone)

EMBL: CP000904.PE101

CP000904.PE101       Location/Qualifiers
FT   CDS_pept        complement(146799..147992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5543"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46525"
FT                   /db_xref="GOA:A9VV93"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV93"
FT                   /protein_id="ABY46525.1"
FT                   /translation="MKKILFAILSVIVVTVLVYYFFFSNSNVDLISEEDVQKKDFLKDK
FT                   QSVIYLSSTADQDMDGKGISYAVFINKNGEASGYKMNGLELGGIGVSENKKELLLESKD
FT                   KLKFVGENFKEFKMKYQHTGDYRAYLKNSDLFVNIYNSGSNPDTGGYDSNVVYGNKKGI
FT                   HKGNIPHYLISAGVDEETIPIMTHDIDKKEYTLKRLTFNDLKMKLEDVTEISVDKNMTY
FT                   SSYSSILSDSNSYYTVLVENDNTIKGKVYLLRVNKTTLKQELVLLSSEEDSTASIPFTK
FT                   NNSAYLHNNELYFINGLGNVITFNTQTNTVNTKFKIDYSVTDGVRYNEQTFFQGDQLYV
FT                   LRYDKNRKNNYYIEIYSLKDGKKIKETEISGMEEIIKSVRGGKSIHAYDFKVLDQSN"
     atgaaaaaaa tactatttgc tattttaagt gtaattgtgg ttacagtatt agtctattat        60
     ttctttttta gtaactcaaa tgtggattta atatctgagg aagatgttca aaaaaaggat       120
     tttttaaagg ataagcaatc tgtaatatac ctttcttcta cagctgatca agatatggat       180
     ggtaagggga ttagttatgc cgtgtttatt aataagaatg gcgaagcaag tggttataaa       240
     atgaatggtt tagagcttgg tggtatagga gtatcggaaa ataaaaaaga acttttatta       300
     gaaagtaagg ataagcttaa atttgtagga gaaaacttta aagagtttaa gatgaaatac       360
     caacatacag gagattacag agcatattta aagaacagcg acttgtttgt gaatatctat       420
     aattctggca gtaatcctga tactggagga tatgattcaa atgtcgtata tggtaataaa       480
     aaaggcattc ataaagggaa tattccacat tatcttataa gcgctggagt ggatgaagaa       540
     actattccaa tcatgactca tgacatagat aaaaaagagt atactttaaa aaggttaaca       600
     tttaatgatc taaagatgaa acttgaagat gttactgaaa ttagtgtaga taaaaacatg       660
     acatattcta gttattcttc tattttaagt gattcaaatt cttactatac ggttttagtt       720
     gaaaatgata atacaattaa aggtaaagtt tatttgttgc gtgtcaataa aacgacattg       780
     aagcaagaat tagttttgtt gtcttccgaa gaagactcta cagcttcaat accttttacc       840
     aaaaataatt ccgcttatct acataacaat gagctatatt ttataaatgg attaggcaat       900
     gttattacgt ttaatacaca gacaaataca gtaaatacta agtttaagat tgattatagc       960
     gtaacagatg gggttagata taatgagcaa acattcttcc agggagatca attatatgta      1020
     ttaaggtatg ataaaaatcg aaaaaataat tattatatag aaatctattc tttgaaagat      1080
     ggtaagaaaa ttaaagaaac tgaaattagt ggtatggaag aaattattaa atctgtccgg      1140
     ggagggaaat caattcatgc ttatgatttt aaagtgttag atcaaagcaa ttaa            1194
//

If you have problems or comments...

PBIL Back to PBIL home page