(data stored in ACNUC9435 zone)

EMBL: CP000904.PE102

CP000904.PE102       Location/Qualifiers
FT   CDS_pept        complement(148055..148792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5544"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46526"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV94"
FT                   /protein_id="ABY46526.1"
FT                   /translation="MKKIHALTLTIGLITSAMAVPTATFAGSEELPHLSEIKKMQPDLS
FT                   TSELLSSIDEMAKNTGNTKDAIAEQIYKELKADEALGTKEANEKVKTLGAGGGTVSVGN
FT                   SNMGDFFYTGSYTAYLNHGHVGMYYSSNTIVESVPDNGVRTLSTTARKVDKGDAVVKSI
FT                   NTSWQNKNDAAWWAKDRVGKDGYSYNFATNRSTTHYGAKNCSKLIWSAYKLNGGLDLDK
FT                   DGGAGVYPRDVRDAKQTSTIRNI"
     atgaaaaaaa tacatgcatt aacattaaca attggtttaa taacttcagc tatggctgta        60
     cctactgcta cttttgccgg aagtgaagag ttacctcatt tgagtgaaat taagaaaatg       120
     caacctgatc tgagtacatc ggaattatta tcaagtattg atgaaatggc aaaaaataca       180
     ggaaatacga aagatgcaat tgctgaacaa atctataaag aactcaaagc agatgaagct       240
     ttaggtacaa aagaagcaaa tgaaaaagta aaaacattag gagctggcgg tggtacagtt       300
     tctgtaggta atagcaatat gggggacttc ttttatactg gttcttatac tgcatatttg       360
     aatcatggac atgttggtat gtactatagt tcaaatacaa tagtagaatc tgttccagac       420
     aatggagtac gtacacttag cacaacagct cgaaaagtag ataaaggcga tgctgttgtc       480
     aaatctatta atacttcttg gcaaaataaa aatgatgctg catggtgggc gaaagatcgt       540
     gtaggtaaag acggatattc ttataatttc gctacaaata gaagtaccac tcattatgga       600
     gctaaaaatt gttcaaaact tatttggtca gcatataagc ttaatggtgg tttagactta       660
     gataaagatg gtggagctgg cgtatatcca cgagatgttc gtgatgcaaa acagacatca       720
     acaattagaa atatctaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page