(data stored in ACNUC9435 zone)

EMBL: CP000904.PE103

CP000904.PE103       Location/Qualifiers
FT   CDS_pept        complement(150137..150811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5546"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: btk:BT9727_1601 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5546"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46527"
FT                   /db_xref="GOA:A9VV95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV95"
FT                   /protein_id="ABY46527.1"
FT                   /translation="MIKLINLEKTYKLGKKTQYVIQGIDLIVEQGEMLAIMGRSGAGKS
FT                   TLLHILAGLEKPNGGSYYFQDKDITQLSYKELALFRKNNIGFILQNHALIEDKNIFDNV
FT                   ALPLLYGKASKKEIHSKVLKILQEMGLEDKVDQYPSELSGGEAQRIAIARALINDPDLI
FT                   LADEPTGSLDEETEQTILNLFTQLNRIGKTFILVTHDETVANVCNRVIRLKDGYIHDGS
FT                   VK"
     atgattaaat taattaattt agaaaaaact tataagctag gaaaaaaaac acaatatgtt        60
     attcaaggga tagatttaat tgttgaacaa ggggaaatgt tagcaatcat gggaagaagc       120
     ggtgcaggga aatcgacttt actgcacata ctagctggat tagaaaaacc aaatggcgga       180
     agttattact tccaagataa agatatcaca cagcttagtt ataaagaact tgctttgttt       240
     agaaaaaata atataggttt tattttacaa aatcatgcac ttattgaaga taaaaatata       300
     ttcgataatg tagctttacc attattatat ggtaaggctt caaagaaaga gattcactct       360
     aaagtgttaa agatattaca agaaatgggt ttagaggata aagttgatca atatccaagt       420
     gaattgtctg gtggagaagc tcaaagaatt gccattgcac gggctttaat aaatgacccg       480
     gatctgattt tagctgatga acctaccggt tctttagatg aagagaccga gcaaacaatt       540
     ctaaatcttt ttacacaatt gaatagaata ggaaaaacat tcatattggt tactcatgat       600
     gaaacagtcg ctaatgtttg taatcgagtt attagactta aagatggtta tattcatgat       660
     ggatctgtaa agtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page