(data stored in ACNUC9435 zone)

EMBL: CP000904.PE104

CP000904.PE104       Location/Qualifiers
FT   CDS_pept        complement(150816..152099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1600 conserved hypothetical
FT                   protein, possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5547"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46528"
FT                   /db_xref="GOA:A9VV96"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV96"
FT                   /protein_id="ABY46528.1"
FT                   /translation="MRTLLIELKESLLKKKMLSILILLQTCLLFALISALYLSFYKIDT
FT                   KTKSFYAQYEGKNIYKLSDQLFDEKEVEFFSNPNELLKVKNFYHTLLNSKDFLYLNTTL
FT                   QHIGVQNFKGQSIFLQGYEKGDPRPPYQKKEGLPSFDRVKSIQINDNVLSTFDVKVQKG
FT                   RVFNKEDFLFKKGTKIPIILGAEYQSTYNVGDTIYFDYLNQELEGMIVGILQKNTSFPV
FT                   NGDSEFYADRYVILPEFIMEEVPQNAEVLSFQQKHYLHAINGQIFTNKDMISVQKVVNA
FT                   ISQKVSFDDYIIIGANTIGISLMFTMMKQNIQLMSLFTAVIFIFCIISISLSLIMKWDT
FT                   NIKKYAIHLISGATVPQILLYAFAEILCVICLSLTLIFSFMQLVGEMPISYYFTLLGVS
FT                   LIIIVLGMLPFSFKLNQSNIVKILKKKE"
     ttgagaacat tattaattga attgaaagaa agtttgttga agaaaaagat gttatcgatt        60
     ttaattttat tacagacatg tttgttattc gccttaatat ctgcattgta tctatctttt       120
     tataagatag atacaaaaac gaaaagcttt tatgcacaat atgaagggaa aaatatttat       180
     aaactttcag atcaactgtt tgatgaaaag gaagtagagt ttttttcaaa tccaaacgaa       240
     ctactaaagg tgaaaaattt ttatcacact cttttaaatt caaaggattt cctttacttg       300
     aatacaacgt tacaacatat cggtgttcaa aattttaaag gacaatctat tttccttcaa       360
     gggtatgaaa agggggatcc tagaccacct tatcaaaaaa aggaaggatt accttctttt       420
     gatagagtaa aatctataca aataaacgac aatgtacttt caacttttga tgtaaaagta       480
     caaaaaggga gagtttttaa taaagaagac tttttattta aaaagggaac gaaaatacct       540
     atcattctcg gagcagaata tcaatctacc tataatgtag gagacactat ttattttgat       600
     tatttaaatc aggaattaga aggaatgata gtggggattt tacaaaaaaa cacctcattc       660
     ccagttaatg gtgattcgga attttatgcc gatagatatg ttatcctgcc tgaatttatt       720
     atggaagaag ttccacagaa tgcggaagtt ttaagttttc aacaaaaaca ctacttacat       780
     gctattaatg ggcaaatttt tacaaataaa gatatgattt ctgttcaaaa ggtagttaat       840
     gctatatccc aaaaagtaag ctttgatgat tatataataa taggagcaaa tactatagga       900
     ataagtttaa tgttcacaat gatgaaacaa aatattcagt taatgtcttt gtttactgca       960
     gtaatattta tattctgtat tattagtatt tcactttcat taattatgaa atgggataca      1020
     aatattaaaa agtatgctat tcatcttata tcaggagcaa ccgttcctca aattttattg      1080
     tatgcctttg cagaaatact ttgtgttata tgtcttagcc ttacattaat cttttcattt      1140
     atgcaattgg tgggtgaaat gccgatcagt tattatttta ctctgcttgg tgtaagttta      1200
     ataattatag tattaggtat gttacctttc tctttcaaat taaaccaatc taatatagta      1260
     aaaatattaa agaaaaagga atga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page