(data stored in ACNUC9435 zone)

EMBL: CP000904.PE105

CP000904.PE105       Location/Qualifiers
FT   CDS_pept        complement(152103..153143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5548"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46529"
FT                   /db_xref="GOA:A9VV97"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV97"
FT                   /protein_id="ABY46529.1"
FT                   /translation="MYIKRIKKFTIEDGVLSAYVIIFTLMISLTTTYLIKINGIDKITN
FT                   NFYSKNSVAFHIKDDNRPLNMQNLLDHIDERDFMLFKENVLELPYIKGIYKSGDIATPP
FT                   LVSGRFFQADDFFRNKNIAVVGKDNNDIVLKNDKKYIQLNNTSFEIIGVMGEDFSTKLD
FT                   KMIYLNLDAALKLENESYGSYVLDGNKVMTSTFDRLEQDMRSSISIVKADKETVGSSRV
FT                   FERNRGDYGIFVLFILVILSMSIIICSYWFYKKRISISIQHVIGHRMFNIYMNLFKKHV
FT                   LLLISSYFFSIFMFIIFNLNNIDAHLEKYMYSCGLGILFLCVYHFILCILAMFIYSSKI
FT                   RLKVLK"
     ttgtatataa aacggataaa gaaattcaca atagaggatg gtgtattaag tgcatatgtt        60
     ataattttca ccttaatgat aagcttgact acaacctatt tgataaaaat aaatggcatt       120
     gataagataa caaataattt ttatagtaaa aatagtgtcg cttttcacat aaaagatgat       180
     aaccgcccat taaatatgca gaacctttta gatcatatag atgaaaggga tttcatgctg       240
     ttcaaagaaa atgtgttgga acttccttat ataaaaggaa tttataaatc aggtgacatt       300
     gcaactcccc ccctagtcag cggacgcttt tttcaagcag atgatttttt cagaaataaa       360
     aacattgcgg ttgtcggaaa agataataat gatattgtcc tcaaaaatga taaaaaatac       420
     atccaattaa acaatacatc ttttgaaatt attggtgtta tgggggagga tttttctaca       480
     aaattagaca aaatgatata cctgaattta gatgccgcac tgaaactaga aaatgaaagt       540
     tatggttctt atgtattaga tggtaacaag gttatgacat ctacgttcga tagactcgaa       600
     caagatatga gatcctctat ttctatagta aaagccgata aagaaactgt aggcagttca       660
     agggtatttg aaagaaatag aggggattat ggaatattcg ttctttttat tttagtaata       720
     ttgagtatga gtataataat ttgtagttat tggttttata aaaaaagaat ttcaatttct       780
     atacaacatg taataggaca tcgtatgttt aatatttata tgaatctatt taagaagcat       840
     gttctattac taataagttc ctattttttt agtatattta tgttcataat atttaattta       900
     aacaatatcg acgcacattt agagaaatat atgtattctt gtggtttagg gatattattt       960
     ttatgtgtat atcattttat attatgcata cttgctatgt ttatctattc ttccaaaatt      1020
     agattaaagg tgttgaagta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page