(data stored in ACNUC9435 zone)

EMBL: CP000904.PE106

CP000904.PE106       Location/Qualifiers
FT   CDS_pept        complement(153345..153782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5549"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46530"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV98"
FT                   /protein_id="ABY46530.1"
FT                   /translation="MLRRKTIALGLAGAMILPTGSVFADENTGSKINSQSIEQTEPQNF
FT                   TEYLGWSELESDKEQIQFSNLNYATQGVSHAGWAEYKNDKRRAVGETTWNGVYHYTRAQ
FT                   LKLYWSVKADSGRQWDWHETRAESPWKNEFFSAHTFYGNEK"
     atgttaagaa gaaagactat tgctttagga cttgcaggag ctatgatttt accgaccggc        60
     agtgtatttg ctgatgaaaa cacgggttct aagattaatt cacaatctat agaacagact       120
     gagccacaga actttacaga atatttagga tggagtgaac tagaatctga taaagaacaa       180
     atacaattta gtaatctaaa ttatgcaact caaggggtta gccatgcagg gtgggcagaa       240
     tataagaatg ataaaagaag agctgttggt gaaacaacat ggaatggtgt ctaccactat       300
     actcgcgctc aattgaaact gtattggtct gtcaaggcag atagcggtag acaatgggac       360
     tggcatgaga ctagagcaga atctccttgg aaaaatgaat ttttcagtgc tcatactttt       420
     tatggaaatg aaaaataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page