(data stored in ACNUC9435 zone)

EMBL: CP000904.PE107

CP000904.PE107       Location/Qualifiers
FT   CDS_pept        complement(154580..155275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5550"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gfo:GFO_0338 gliding motility protein GldA"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5550"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46531"
FT                   /db_xref="GOA:A9VUG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG0"
FT                   /protein_id="ABY46531.1"
FT                   /translation="MTVLNIKEVCKRYKKKIALSPISFQSKQGECIVLCGGNGAGKSTL
FT                   LDIIAGITTPTTGTVQLGNIELQKDRKQYVSEIGYMPDDFHAQQDMTVQEFLFFYAAFR
FT                   NIGKEKVQAVIKSIGLNEKKNERLHRLSKGMRQRLLFGQAYLGNPKILILDEPTNGLDP
FT                   YWVDEFLTILKTLKRDGTMIIFSTHMMDVAAEIGDRILFMKEGKVIQEIKNDGDLENLT
FT                   ITLLQMHRR"
     atgacagtat taaatatcaa agaagtatgt aaaagatata aaaagaaaat agcattatct        60
     ccaatctcat ttcaaagtaa acaaggagag tgtatcgtat tatgcggtgg gaatggagca       120
     gggaaaagta cgctccttga tataattgct ggaattacaa cacctacaac tggtaccgtt       180
     caattaggga atatagaatt acagaaagat agaaaacagt atgtgagtga aataggttat       240
     atgccagatg attttcatgc acagcaagat atgacagttc aagaattttt attcttttat       300
     gctgcttttc gaaatatagg aaaagaaaaa gtacaggcag ttattaaatc aataggctta       360
     aatgagaaaa aaaatgaacg gttacataga ttatctaaag ggatgagaca gaggctatta       420
     tttgggcagg cgtaccttgg aaatcctaaa attttgatat tagacgaacc gacaaatggc       480
     ctggatccgt attgggtaga tgagttttta acaatattaa agactttaaa aagagatggt       540
     accatgatca ttttttccac acatatgatg gatgtagctg ctgaaattgg tgaccggata       600
     ctctttatga aagaaggaaa agtcatacag gaaattaaaa atgatggaga tttagaaaat       660
     ttaacgataa cattactaca aatgcataga agataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page