(data stored in ACNUC9435 zone)

EMBL: CP000904.PE108

CP000904.PE108       Location/Qualifiers
FT   CDS_pept        complement(155272..156084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5551"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46532"
FT                   /db_xref="GOA:A9VUG1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG1"
FT                   /protein_id="ABY46532.1"
FT                   /translation="MWNILYSEWRSAVRGKLAYMFLFLWITIFSLIFVMERNTPSLVGY
FT                   TNVAGTMVNLILYIVPLLMLIIGAFSIAGEVENGKWRLLCTYPLKSTSYVIGKIIGQFI
FT                   AQTAIFSMSFGVSIIIGLVSGSNFDIFWMVATYIFSVLLIFLFLLLGITIGSFSITRWQ
FT                   ALAISIVVWFFLIMMWPTALISVLNFVPYSMIAPLIKMFLFCNPAEFLRIIFVIQLGGG
FT                   AIFGQVYDQLVMIFQSKAVIWILLIYCIIYTIVFLFVAGWQMERRRKK"
     atgtggaata tattatattc agaatggcgt agtgcagtaa ggggtaaact tgcatacatg        60
     tttttgtttc tttggataac tatattttct ttaatatttg ttatggaaag aaataccccg       120
     tctttagtag gttatacaaa tgtggcgggg acaatggtaa accttatttt atatattgta       180
     cccttactta tgttaattat aggagcattt tctatcgcag gcgaagtgga aaatgggaaa       240
     tggagacttt tatgtacgta tcctttaaag agtacctcat atgtaatagg taaaataatc       300
     ggtcaattta tagcgcaaac agctattttt tcaatgagtt ttggagtaag tataatcatt       360
     gggttagtaa gcggtagtaa ttttgatata ttttggatgg tagcaacgta tatcttctct       420
     gttttattaa tttttttatt tttattactg ggaataacaa tcggttcttt ttctataact       480
     aggtggcaag ctttagccat aagtatcgta gtttggttct ttcttattat gatgtggcca       540
     acggctttaa ttagtgttct taattttgtt ccatattcaa tgattgcgcc attaataaaa       600
     atgttcttgt tttgcaaccc agcagaattc cttcgaatta tatttgtaat tcaattaggt       660
     ggtggagcaa tatttgggca agtatatgat caattggtaa tgatttttca aagtaaagct       720
     gttatttgga ttctactaat atactgcatt atctatacaa tcgtgttctt gtttgtggcg       780
     gggtggcaaa tggagaggag aagaaaaaaa tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page