(data stored in ACNUC9435 zone)

EMBL: CP000904.PE11

CP000904.PE11        Location/Qualifiers
FT   CDS_pept        30409..31095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5443"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46435"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV03"
FT                   /protein_id="ABY46435.1"
FT                   /translation="MENIENIEVVGEVGIVEHPIFIEKEEPVELPISLEVEHPCWEVDE
FT                   EGYVVEHYLMSDSKIEIALSEGRRVLKSCWKESFYKPRFDEAINDWVEGADMEEILNLF
FT                   KTNKFDELNQACNKDISGYFDAPVGSETYTFSFDGEAQANFIGSLALFNEGLMKEVEWT
FT                   AWKGEKPHRVNLSKEQFMNVAFVAYQEKDTKISKLRNTLQPRIEACTTIEEVQAIYWNE
FT                   KPTLLA"
     atggaaaata tagaaaatat cgaagtcgta ggtgaagtag ggattgtaga acaccctatt        60
     tttatagaaa aagaagaacc tgtagagctt cctatttctc tcgaagtaga acatccatgt       120
     tgggaagtag atgaagaagg ttatgttgtt gaacattatt taatgtcaga tagcaaaata       180
     gaaatagctt tatctgaagg acgaagagtt cttaagtctt gctggaaaga aagtttttat       240
     aaaccaagat ttgatgaagc tataaatgac tgggttgaag gtgctgatat ggaagagatt       300
     ctaaacctat ttaaaacaaa taagtttgat gaattaaatc aggcatgcaa taaagatatc       360
     tccggatatt tcgatgctcc cgttggttca gagacctata cattttcatt tgatggagaa       420
     gcacaagcta attttattgg tagcctagca ttattcaatg aagggttgat gaaagaagtt       480
     gagtggactg catggaaagg tgaaaaacct catagagtta atctaagcaa agaacaattt       540
     atgaatgtag catttgtagc gtatcaagaa aaggatacaa agatatccaa gttgcgaaat       600
     acattgcagc cacgaattga agcatgtaca actattgaag aagtacaagc tatctattgg       660
     aatgaaaagc caacattact agcttga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page