(data stored in ACNUC9435 zone)

EMBL: CP000904.PE110

CP000904.PE110       Location/Qualifiers
FT   CDS_pept        complement(156672..157949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5553"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   gtn:GTNG_1732 copper binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5553"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46534"
FT                   /db_xref="GOA:A9VUG3"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG3"
FT                   /protein_id="ABY46534.1"
FT                   /translation="MKKICSPLLLLLVFCFPGVSIHAESTLQSKIDAASPYETITLENR
FT                   AYNETIKISKPLTIQGDKNTKIISCGKDPVITINKENIILKDLKIEQCNDNTDQPAIFV
FT                   EGDKHYISGLEVHTSYIGIKLENARDIKIENSMIVGQRRANGIDLWQSNRNLIENIKIQ
FT                   NARDGIYLEQSDNNTIKENTIWQSRYGIHLMYSDRTVVEKNISKENTTGAMIMGTKETS
FT                   VVGNRFIYNKSNVHAQGLLLYDATKTKVLQNEIANNRVGVYVEKADHNTIMDNSISNNF
FT                   IGLQFKDASANEFTQNVMMGNVNESQATQSRENNIYNNYWDASLKVDADGSGTSNIPYK
FT                   ADAYFLLLTQDIPEYQLFFQSPGMRILQSFIKIPDQSLLLDKEPSMRPKGVPQKGEGMA
FT                   FQSNILIVSVSMLLMGSILFILGRKN"
     atgaagaaga tttgttctcc tcttctgtta ttattagttt tttgttttcc aggagtaagt        60
     attcatgcgg agtctacatt acaatcaaaa attgacgcgg cttccccata tgaaacaatt       120
     acattagaga atagagctta taatgaaaca attaaaatat cgaaaccgct tacaatacaa       180
     ggagataaaa atactaaaat aatctcttgt ggtaaagatc ctgtcattac aataaataag       240
     gaaaacatta tccttaaaga tttgaaaata gaacaatgta atgataatac ggatcagcca       300
     gcaatatttg tagagggaga taagcactac atcagtggat tggaagttca tacgtcatat       360
     atagggatta agttagaaaa tgctagggat ataaagattg agaatagtat gattgttgga       420
     caaagacggg ccaatggaat tgatttatgg caatccaatc gcaatcttat tgagaacatc       480
     aaaatccaaa atgcccgtga tggtatttat ttggaacaaa gcgacaataa tacaataaag       540
     gaaaatacaa tctggcagtc tcgttatggc attcatctta tgtattctga taggacagtt       600
     gttgaaaaaa atatatcaaa agaaaataca acaggtgcta tgattatggg aacaaaggaa       660
     acatctgtag taggaaatcg ctttatttac aataaaagta atgttcatgc acaaggctta       720
     ttactatatg atgcgacaaa aacaaaagtt ttacaaaatg aaattgctaa taatagagta       780
     ggggtttatg tagaaaaggc agatcacaat actattatgg ataactcaat ttctaataat       840
     tttatcggtt tacaatttaa agatgccagt gcaaatgaat ttactcaaaa tgtaatgatg       900
     gggaatgtta atgaatcgca agctacacaa agcagggaaa acaatatcta taataattat       960
     tgggacgctt ctttaaaagt agatgcagac ggttcaggta ctagtaatat tccatacaaa      1020
     gcagatgcct attttcttct gttaacacaa gatattccag aatatcagtt gttctttcaa      1080
     tcaccaggga tgcgtatttt acaaagtttc ataaaaattc cagatcaatc tttattgcta      1140
     gataaagagc ctagcatgag gccaaaaggt gttccgcaaa aaggtgaggg gatggcattt      1200
     cagtctaaca ttttgattgt aagtgtaagt atgttactaa tgggaagtat attgtttatt      1260
     ttagggagga aaaattga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page