(data stored in ACNUC9435 zone)

EMBL: CP000904.PE111

CP000904.PE111       Location/Qualifiers
FT   CDS_pept        complement(158176..158484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5554"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46535"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG4"
FT                   /protein_id="ABY46535.1"
FT                   /translation="MEHNKKAAIGDYVQFSYRKNPNLQLTGFVVSVLQNTIVVDVSQIM
FT                   KIEVDDVRQVVKHGYYKKVVHAQIKNNIHNSYTAALTNFSFVRNSITTCSNFLTGFM"
     atggagcata acaaaaaggc agcaattggg gattacgttc aattttcata tcgtaaaaat        60
     cctaacttac aattaacggg atttgtagtg agtgttctgc agaatacaat tgttgtagat       120
     gtttcacaaa taatgaaaat tgaagtagat gatgttaggc aagtagtaaa acatggttac       180
     tataaaaagg tggtacatgc gcaaataaaa aataatattc ataactctta tacggctgcc       240
     ttaacaaact tttcttttgt acgtaattca ataactactt gtagtaattt cttgactggg       300
     tttatgtaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page