(data stored in ACNUC9435 zone)

EMBL: CP000904.PE113

CP000904.PE113       Location/Qualifiers
FT   CDS_pept        complement(160521..160775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5556"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46537"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG6"
FT                   /protein_id="ABY46537.1"
FT                   /translation="MSIISITKSQDSIMIAWQSAEITIPLKDIITISTNDVPHNKLDHV
FT                   VYIGTPSSSKNRILVHTTNLNFIIFVVNPSIILEEINIE"
     atgtcaataa ttagcataac aaagtcccaa gatagtataa tgattgcatg gcaatcagca        60
     gagattacca tccctttaaa agatataatt actatatcta cgaatgacgt tcctcataat       120
     aagctcgatc atgttgttta tattggaact ccatcttcct cgaagaatag aatactagta       180
     catactacaa acttaaactt cattatattt gttgttaatc catctataat cttagaagaa       240
     attaatattg agtaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page