(data stored in ACNUC9435 zone)

EMBL: CP000904.PE114

CP000904.PE114       Location/Qualifiers
FT   CDS_pept        complement(161740..162399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5557"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: bce:BC2447 chloramphenicol
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5557"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46538"
FT                   /db_xref="GOA:A9VUG7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG7"
FT                   /protein_id="ABY46538.1"
FT                   /translation="MKHPLFNHWSETKYLKDIVTNPLIEVGEYSYYSGYYGHQNFEDSC
FT                   VRYLWGDVKSRALFNPIEQMGWHLDKLIIGNYVCIATGVVILMGGNHNHHSEWVTVYPF
FT                   VEQIKQSFEPKGDTVIKSDAWIGMNAIIMPGVTIGEGAIIAAGSVVSKDVPPYTIVGGN
FT                   PAKEIKKRFTDTEISMLMEMRWFDWNRELVERAIPLLSSPSIEQLYNFYKSEVKNK"
     atgaagcatc cattatttaa tcattggtct gaaacaaagt atttaaaaga tatagtaaca        60
     aatccactta ttgaagtagg agagtactcc tattattcag gatattatgg acatcaaaat       120
     tttgaagata gttgtgtaag atatttgtgg ggagatgtta agtctcgagc gcttttcaat       180
     ccaattgaac aaatgggttg gcatcttgat aaactcataa tcggaaatta tgtatgtatt       240
     gcaactggag ttgtcatatt aatggggggt aatcataacc accactcaga atgggttaca       300
     gtttatccat tcgttgagca aataaagcaa tcatttgaac cgaagggtga tacagtcata       360
     aaaagtgatg cttggattgg tatgaatgct ataatcatgc ctggtgttac aattggcgaa       420
     ggtgcaatta ttgcagctgg atctgtagtt tctaaagatg ttccaccata tactatagtt       480
     gggggtaatc ccgctaaaga aataaaaaaa cggttcactg atacagaaat tagtatgtta       540
     atggaaatgc gttggtttga ttggaataga gaattagttg agagggcaat tcctctttta       600
     tctagtccat ctatagagca gttatacaat ttctataaaa gtgaagtgaa aaataaataa       660
//

If you have problems or comments...

PBIL Back to PBIL home page