(data stored in ACNUC9435 zone)

EMBL: CP000904.PE115

CP000904.PE115       Location/Qualifiers
FT   CDS_pept        complement(162693..162992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5558"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bat:BAS3065
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5558"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46539"
FT                   /db_xref="GOA:A9VUG8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG8"
FT                   /protein_id="ABY46539.1"
FT                   /translation="MTRFANHHVDNTILEEDVELLKVMAHPMRLKLISELSKHKTLNVT
FT                   QMTEILNIPQSTVSQHLSKMRGKVLKGNRQGLEIYYSIQNPKAEEIMGLLGPVQ"
     atgacgagat ttgcgaacca tcatgtagat aacacgattt tagaagagga tgtagagctt        60
     ttaaaagtta tggcacaccc aatgcgttta aaattgatca gtgagctttc taaacataaa       120
     acactaaatg taacccaaat gactgaaatt ttaaatattc cacaatccac agtatcccaa       180
     catttatcaa aaatgagagg gaaggtttta aaggggaatc gtcagggatt agaaatttac       240
     tatagcatcc aaaatcctaa agctgaagaa attatggggt tattaggtcc agtacaataa       300
//

If you have problems or comments...

PBIL Back to PBIL home page